KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0004Help
Entry
NGTW08_0004       CDS       T01927                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2436..3092
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQGLAYADMELPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDAERQKRAKAVLD
GLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVTLVPEVLKEQLKDGGRMAVIVGRRPVQ
RALLITRRGDVFEEKVLFDTLVAHLDDKDAHPFDSFNF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcagatccgtccttgggatgta
ttggattttgacgtgttggacgctttggaggagattccgcgcgagcttttcgcggatgag
tctttgcagggtttggcgtatgcggatatggagctgccgcttgccaacggtcataagatg
ctcgagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgacggctctgttggcaaaactggctggc
cgtgtggtttcggacgacatcgatgccgaacggcaaaagcgcgccaaagcggttttggac
ggcttgtctttggaaaacatcgattatgtgcaaaataacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttacgtcggcggcgcggtaacccttgtgcctgaagtgtta
aaggaacagttgaaggacggcgggcgtatggcggttattgtgggacgcaggccggtgcag
cgcgcgcttttgattacgcgcaggggcgatgtgtttgaagagaaggtgctgttcgatact
ttggtggcgcatttggacgacaaggatgcccatcctttcgacagttttaatttttga

DBGET integrated database retrieval system