KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0114Help
Entry
NGTW08_0114       CDS       T01927                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NGTW08_0114
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NGTW08_0114
Enzymes [BR:ngt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NGTW08_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(131005..132090)
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDSEGAETAETHAEHIGWVLATELSA
CGIDLSFTPVLDLDWGNCAVIGNRSFHRNPEAVARLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDGRSLDELEAADLAPFRIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIILVCNRPDLVDELRD
GFTIPDNQDLAGRWQYMENSLGHEAVQAVIQTTGFQAAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accgaagaagaaaaacaacgcctgctcgatcccgcaatcggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacaactcaaaacactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggttttacccgcctgcccgcaatgagtacgctcggcgagatttgggacagtgaaggcgcg
gaaactgccgaaactcatgccgaacacatcggatgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgcgccgtc
atcggcaaccgcagcttccaccgcaatcccgaagcggtcgcccgcctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcatgcggcaaacatttccccggacacgga
tttgtcgaaggggacagccatttggtgctacccgaagacgggcgcagcctcgacgaactc
gaagccgccgacctcgcccccttccgcattatgagccgcgaaggtatggcggcggtcatg
cccgcccacgtcgtttatccgcaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgatatcggattcaaaggcgtgattttttctgacgatttg
accatggagggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcatattggtctgcaaccgtcccgacttggtcgatgaattgcgcgac
ggtttcaccattcccgacaaccaggatttggccggacgttggcaatacatggaaaactcg
ctcggtcatgaggcggtacaagccgttatacagacaacgggtttccaagcggcgcaagcc
tttgttgccggccttgcctcgccgcaggacacggcgggcggcgtaaaagtcggagaggcc
ttttaa

DBGET integrated database retrieval system