KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0258Help
Entry
NGTW08_0258       CDS       T01927                                 

Definition
putative UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NGTW08_0258
   00052 Galactose metabolism
    NGTW08_0258
   00500 Starch and sucrose metabolism
    NGTW08_0258
   00520 Amino sugar and nucleotide sugar metabolism
    NGTW08_0258
Enzymes [BR:ngt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NGTW08_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(277532..278401)
Genome map
AA seq 289 aa AA seqDB search
MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETVEPSQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgataaaaaaagccgtcttccccgttgcagggatgggaacccgcttcctgccc
gccaccaaggccaacccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccgggcgcaac
aagcgcagcatcgaagaccatttcgacaaggcatacgaactcgaaactaagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggattgggacacgccgtcttgtgcgcccgcgcc
gccatcggcgacgaacccttcgccgtcatccttgccgacgacttaatcgatgcgcccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgggcgcagcggtaacagcattttgggcgta
gaaaccgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgttgtcggacgctacatcctcaccccgcgcattttcgaccttttaaccggcctg
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcttggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactcggc
tatctcgaagccaccgtcgcctacggtttaaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgcaccgaataa

DBGET integrated database retrieval system