KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0287Help
Entry
NGTW08_0287       CDS       T01927                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ngt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ngt00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ngt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302589..303374
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPIHKMGYREFAQEAAKAG
VDGVLTVDSPIETIDSLYRELKDNEVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESARKIGRVAAAIIVGSRIVKEIEN
NAGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attgcggtgggcgatcccgatattcggacaactttggcattgatgcacggcatggttgca
agcggtgcggatattttggagttgggcgtgccgttttccgatccgatggcggacgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaatcccatacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggg
gtggacggcgtgttgacggtggattcccccatcgaaaccatcgattctttatatcgcgag
ctgaaggataacgaggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcgtcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgccgcgatcattgtcggcagccggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgccgccgtcggtgctttggtcaaagagttaaaggatgccgtg
cgctga

DBGET integrated database retrieval system