KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0357Help
Entry
NGTW08_0357       CDS       T01927                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGTW08_0357
Enzymes [BR:ngt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NGTW08_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(374579..375073)
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLDNPAQQIRGALDALSSHPDIRLEQASSLYMTAPVGYDNQPDFINA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDPRLTLPHPR
AHERSFVIRPLAEILPDFILGKYGKVVELSKRLGNQGIRLLPDR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccttgggcagcaaccttgacaaccccgcacaa
caaatacgcggcgcattagacgcgctctcgtcccatcctgacatccggcttgaacaggct
tcctcactgtatatgaccgcacccgtcggttacgacaatcagcccgatttcatcaatgcc
gtctgcaccgtttccaccaccttggacggcattgccctgcttgccgaactcaaccgtatc
gaagccgatttcggacgcgaacgcagtttccgcaatgcaccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacccccgccttaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatacgccctttggcagaaatcctccctgattttattttg
ggaaaatacggaaaggttgtcgaattgtcaaaacggctgggcaatcaaggcatccgtctt
ttaccggacaggtaa

DBGET integrated database retrieval system