KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0394Help
Entry
NGTW08_0394       CDS       T01927                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGTW08_0394 (hemD)
Enzymes [BR:ngt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NGTW08_0394 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
402668..403432
Genome map
AA seq 254 aa AA seqDB search
METAKPVMLIVRPSGRAKDDVEVCRRAGWQAEVLSPIEIETDEASLKRLPEMYARADAVF
WVSPAAVETAVPYLNLSDGIKAHIAVGQGSRRALARYAGAGVFAPEDGNDSEAVLRLPVW
NSLPEGARVLSVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYI
TSTELVQSLFAQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSYSSI
SVSDGMVFPGTSNQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagcgaagcccgtcatgctgattgtccgcccgtcgggcagggcgaaggacgat
gtggaagtctgccgtcgtgccggatggcaggcggaagtgttgagtccgattgaaatcgaa
accgacgaagcaagcctgaaacggctgccggaaatgtatgcccgtgcggatgccgtgttt
tgggtcagtccggccgccgttgaaaccgccgtcccgtaccttaacctttcagacggcata
aaggcgcacattgccgtagggcaaggcagccgccgtgccttggcgcgttatgcgggcgcg
ggcgtgtttgcacctgaagacggcaacgacagcgaggcggttttgcgcctgccggtttgg
aacagtctgcccgaaggtgcgcgcgtattgtctgtgcgcggacacggcgggcgggatttt
ctgatgaatgccttgcaggagaaaggttttcggacggaggtggcagaagtctatttcaga
cggcataaacctttgaactttcaaaatttccaaaccgaaaatattgccgccgcctatatt
acgtccacagaacttgtgcagtcgctgtttgcacagcttccgccgcaattttcccgattc
ttcaaatccttgctatactttacccatcatccgcgcattgcggaggcattgaagcgcgaa
ggcgtgtgttcggtcgaaaccgtccctacgctggaagccgcgctttcctattcttccatt
tccgtttcagacggcatggtctttcccggaacctcaaaccaataa

DBGET integrated database retrieval system