KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0410Help
Entry
NGTW08_0410       CDS       T01927                                 

Definition
protein Pgm
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGTW08_0410
   00030 Pentose phosphate pathway
    NGTW08_0410
   00051 Fructose and mannose metabolism
    NGTW08_0410
   00052 Galactose metabolism
    NGTW08_0410
   00500 Starch and sucrose metabolism
    NGTW08_0410
   00520 Amino sugar and nucleotide sugar metabolism
    NGTW08_0410
  Nucleotide metabolism
   00230 Purine metabolism
    NGTW08_0410
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NGTW08_0410
Enzymes [BR:ngt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NGTW08_0410
    5.4.2.8  phosphomannomutase
     NGTW08_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(421471..422853)
Genome map
AA seq 460 aa AA seqDB search
MASITRDIFKAYDIRGIVGKTLTDDAAYFIGRAIAAKAAEKGIARIAIGRDGRLSGPELM
EHIQRGLTDSGIGVLNVGMVTTPMLYFAAVNECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLAIVEKDGFVAADKQGSVTEKDISGAYHDHIVGHVKLKRPINIAIDAGNGV
GGAFAGKLYKGLGNEVTELFCEVDGNFPNHHPDPSKPENLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLNRNPGAKVIFDVKSTRLLAPWIKEHGGEAIM
EKTGHSFIKSAMKKTGALVAGEMSGHVFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
DNLPQSISTPELNISLPEGSNGHQVIEELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQAAIERIQNRFKAVIESNPHLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatcacccgcgacatcttcaaagcctacgacatccgtggcatcgtcggcaaa
accctgaccgacgatgccgcttatttcatcggcagggccatcgccgccaaagccgccgaa
aaaggtatcgcccgcatcgcgatcggacgcgacggacgcttgagcggccccgaactgatg
gagcacatccaacgcggcctgaccgacagcggtatcggcgtactcaatgtcggcatggtt
accactcctatgctctacttcgcagccgtcaacgaatgcggcggcagcggagtgatgatt
accggcagccacaatccgcccgattacaacggtttcaaaatgatgctcggcggcgacacg
ctcgcaggcgaagccattcaagaacttttagctattgttgagaaagacggttttgttgcc
gccgacaaacaaggcagcgtaaccgaaaaagacatctccggcgcataccacgaccacatc
gtcggacacgtcaaactcaaacgcccgataaacatcgccatcgacgcgggcaacggcgtg
ggcggcgcgtttgccggcaaactctacaaaggtttgggcaacgaagtgaccgaacttttc
tgcgaagtggacggcaatttccctaatcaccaccctgatccttccaaaccggaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtggttaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcccaagacgttttgaaccgcaatcccggcgcgaaagtcattttcgat
gtcaaatccacacgcctgcttgccccgtggattaaagaacacggcggagaagccataatg
gaaaaaaccggccacagcttcatcaaatccgctatgaaaaaaaccggtgcactggttgcc
ggcgaaatgagcggacacgttttctttaaagaacgctggttcggcttcgacgacggcctg
tatgccggcgcacgcctcttggaaatcctgtccgcctccgacaatccgtccgaagtgttg
gacaacctgccgcaaagcatttccacgcccgaactcaacatctccctgcccgaaggcagc
aacgggcatcaagttatcgaagaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggcctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattttggtgttgcgttttgaagcggatacgcaagcagccatcgag
cgcattcaaaaccgattcaaagccgtcatcgaaagcaatccgcatttaatctggcctctg
taa

DBGET integrated database retrieval system