KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0420Help
Entry
NGTW08_0420       CDS       T01927                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGTW08_0420
Enzymes [BR:ngt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NGTW08_0420
Exosome [BR:ngt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGTW08_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
430704..431705
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLEGAAREEDVPSMPGVKR
QSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRAQEAYNPEGLVPSTVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGTQVVAPSDMMDGRIG
AIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
HEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVANGWLDG
GKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggatgat
ttttcacgccgcctgatgcgcgagcatatgctgaccgccgatgatttgatttatccggtg
ttcgtattggagggggcggcgcgcgaggaggatgtgccttctatgccgggcgtgaagcgt
cagagtttggacaggctgctgtttacggcggaagaggcggtgaagctcggtattccgatg
ttggcactctttcccgtggttacggcaaacaaaaccgggcgtgcgcaggaggcgtacaat
cccgaaggactcgtgccgtcaactgtccgagccttgcgcgagaggtttcccgaactgggc
attatgacggatgtcgcgctcgatccttatacggtgcacggtcaggacggactgacggac
gaaaacggttacgtgatgaatgatgaaaccgtagaagtcttggtgaaacaggctttatgt
catgcagaggcgggcacgcaggtcgttgctccttccgatatgatggacgggcgtatcggc
gccatccgcgaggctttggaggatgccggacatatccatacgcggattatggcatattcc
gccaaatatgcttctgcattctacggccctttccgtgatgcggtaggcagttcgggcaat
ttgggaaaggcagataaaaagacctatcagatggatcctgcaaataccgatgaggcgctg
catgaagtggcgctcgatattcaggaaggtgcggatatggtgatggtgaagcccggtttg
ccgtatttggacgttgtccgccgcgtgaaggacgagttcggcgtaccgacttatgcctat
caggtttcgggcgaatatgcgatgttgcaggcggcggttgccaacggctggctggacggc
ggcaaagtggttttggaaagcctgctggcattcaaacgtgcgggtgcggacgggattttg
acctattacgccattgaggcggcaaagatgctgaagcgttga

DBGET integrated database retrieval system