KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0478Help
Entry
NGTW08_0478       CDS       T01927                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGTW08_0478 (ipk)
Enzymes [BR:ngt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NGTW08_0478 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486756..487601
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKPRDDGKIILHN
PVGGIPQEADLSYRAASLLQKYARNLAGVEIWLDKKIPTGAGLGGGSSDAATALLVLNRW
WQCGLTQWQLIDLGAALGADVPFFIFGKNAFASGIGEKLIGMDIPKQWYVIVKPPVHVST
AKIFTYEGLTRDSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSKYGSAMMTGS
GACIFAAFQARNSAYNIYRQVSGLYEAYLAEGLSKHPLLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattaccggcaggcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaaccgagggacgacggcaaaatcatcctgcacaat
cctgtcggcggaataccgcaggaagccgatttgagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccttgccggcgtggaaatatggctggacaaaaaaatcccgaccggc
gccggcttgggaggggggagttccgatgccgcaacggctttgctggtgttgaaccgttgg
tggcagtgtggtttgacgcagtggcagctcattgatttgggtgcggctttgggtgcggac
gtaccgttttttattttcggaaaaaatgcttttgcaagcgggataggtgaaaaactgata
ggaatggatattccgaaacagtggtatgttattgtcaaacctcccgtccacgtttccacc
gcaaaaattttcacatacgaaggcttgacacgggattctgcctcaagcataatgccgact
ttccaaaacctgcaaccgttcagaaacgatatgcaggcagtggtatttaaagaataccct
gaagtttggaaagcttattccgagttgtcgaaatacggttctgcaatgatgaccggctca
ggagcctgtatatttgcagcatttcaagctaggaatagcgcatacaatatataccgacaa
gtttcaggtttgtacgaggcatatttggcagagggtctttcaaaacatcctttgttgtcc
gtataa

DBGET integrated database retrieval system