KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0699Help
Entry
NGTW08_0699       CDS       T01927                                 

Definition
putative succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:ngt01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ngt00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ngt00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ngt00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
686498..686839
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFALPKEYPAWQAFFSQAWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtaatgcagcgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctatttgccctg
cctaaagaatatccggcatggcaggcattttttagtcaagcttgggtaaaagtatttacc
caagtgagctttatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccattgtctggctg
gtcggctgcctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system