KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0699Help
Entry
NGTW08_0699       CDS       T01927                                 

Definition
putative succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGTW08_0699
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGTW08_0699
   00650 Butanoate metabolism
    NGTW08_0699
  Energy metabolism
   00190 Oxidative phosphorylation
    NGTW08_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
686498..686839
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFALPKEYPAWQAFFSQAWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtaatgcagcgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctatttgccctg
cctaaagaatatccggcatggcaggcattttttagtcaagcttgggtaaaagtatttacc
caagtgagctttatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccattgtctggctg
gtcggctgcctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system