KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0705Help
Entry
NGTW08_0705       CDS       T01927                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGTW08_0705
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGTW08_0705
  Amino acid metabolism
   00310 Lysine degradation
    NGTW08_0705
Enzymes [BR:ngt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NGTW08_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
694212..695393
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATVAAEAPAAAPAEAAPAAVPAAAQNNAAMPAAAKLAAETG
VDVNVLQGSGRDGRVLKEDVQNAAAKPAAAVAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVTALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPVRLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacactcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcccgtatcgatacagctgct
actgtcgctgctgaagcacctgcagccgctcctgccgaagctgccccggctgccgttcct
gctgctgcacaaaacaacgccgccatgcctgccgctgcaaaactggctgccgagaccggt
gttgacgtgaacgtattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgtggcccctgccgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaaccg
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacatggcgtaaaactg
ggctttatgtccttcttcgttaaagccgctgttacagccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacattgtgtaccacggctacttcgacatcggtatcgca
attggcagcccacgcggtttggttgtaccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagacctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaacccgcctcaatctgcgattttgggtatgcatgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggtccgcctgttgttggatctgtaa

DBGET integrated database retrieval system