KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0844Help
Entry
NGTW08_0844       CDS       T01927                                 

Definition
putative exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGTW08_0844
Enzymes [BR:ngt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NGTW08_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(822970..824748)
Genome map
AA seq 592 aa AA seqDB search
MPSDGISTRNTMELQTDEFAQAAARAAIRFLERYAGSGNEVLANCTERLFQALQNGHSFI
RLSGDEADALSALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAAGTSAPDA
AGARQNLAKWFQGAGSEGQRDAAALALLQFFMVITGGPGTGKTTTVAKLLALICGENENL
PHIALAAPTGKAAAHMARALHRAINGFDAPEAVRRHLLKLEGQTVHRLLKLSPPKMQAAF
DHIRPLPFDVLIVDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSQ
KTVLDGETHQRLAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGD
EGAWALFDRFPDELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAW
RQDAEDFNEAYCSYVRRKMNIPEHLAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQG
SLAAYFADADGFKKVAVSCLPEFEPAFAMTVHKSQGSEYREVWLLPPSDAPSDEGDDALS
GLSKELLYTAITRAREKFVFFGGKKTFCQAVNTVKVRQTALDSMLERVFSQE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcagacggcatttcgacaaggaatacgatggaactgcagacagatgaatttgcc
caagcggcggcaagggcggcaatccgttttttggaacgctatgcgggttcgggcaacgaa
gtgcttgcaaactgtaccgaacgcctgtttcaggcattgcaaaacggtcattcgtttatc
cgtttgagcggggacgaggctgacgcgctgtcggcactcgcacccgtggtcggaacatcc
gccgcgcctttgattttggaaggcagaaggctgtttttgggcaggatgtggcagttggaa
tacgatttggctgccgaaataaaacgcttggcggcagccggcacgtccgcccccgacgcg
gcaggcgcgcggcaaaacctcgcaaaatggtttcaaggcgcgggaagcgaaggacagcgc
gatgcggccgccttggcactgttgcagttttttatggtgattaccggagggccgggaacg
ggcaaaacgacaacggttgccaaactgctggcactgatttgcggtgaaaacgaaaatctt
ccccatatcgcgcttgccgcaccgacgggcaaagcggcggcacatatggcgcgcgcactg
caccgtgcaatcaacggttttgacgcgccggaggccgtccgccgccatttgctcaaactg
gaagggcaaaccgtccaccgactgcttaagctgagcccgcccaaaatgcaggcggcgttc
gaccatatccgtccgctgccgttcgacgtgctgattgtcgatgaagcctccatgttggat
accgcattgatgctgcaacttttgaaagcggtcaaaaccggcgcgcgcgtgattctgctg
ggcgatgaaaaccagctcccgtccgtcggaatcggggcggtgctgtccgttttgtcgcaa
aaaaccgttttggacggagaaacgcaccaaaggctggccggtttccttccggaacacggt
ttcagcgtcagcgcaaatccgcccgtgttggcgcaaaacaccgcccatctgtcgttcagc
caccgcttcggcgacaacagcggcatcggctgccttgcccgtgccgccgtatcgggcgat
gaaggggcgtgggcattgtttgaccggtttccggacgaactggaacattcggaatgcagt
ccgaatgctcgggtcgaaaggttgtaccgggcgcacaaagcctattggcaggcggtaaaa
gacggcaatatcgaagccgcatacgcaggcatctcggatatcgtggttctggcagcttgg
cggcaggatgcggaagacttcaacgaagcctattgcagctatgtacgccgcaaaatgaac
ataccggaacatttggcctatttcgccggagagccgattatgatcagacagaacgactac
gcgcttgagctgttcaacggcgacatcggactgattatggaagatgtcggacggcagggc
agccttgccgcctattttgccgatgcggacggatttaaaaaggtagcggtaagctgcctg
cccgaatttgaacccgcattcgccatgaccgtccacaaaagccaaggttcggaatatcgg
gaagtctggctgctgccgccttccgacgcaccttcggacgaaggggacgatgcattgtcc
ggattgagtaaggagctgttatataccgctattacccgcgccagggaaaaattcgtattt
ttcggcggcaaaaagacattttgtcaggcggtaaacaccgtcaaagtccgtcagacggcg
ttggacagtatgcttgagcgggtattttcacaagaataa

DBGET integrated database retrieval system