KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0844Help
Entry
NGTW08_0844       CDS       T01927                                 

Definition
putative exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ngt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(822970..824748)
Genome map
AA seq 592 aa AA seqDB search
MPSDGISTRNTMELQTDEFAQAAARAAIRFLERYAGSGNEVLANCTERLFQALQNGHSFI
RLSGDEADALSALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAAGTSAPDA
AGARQNLAKWFQGAGSEGQRDAAALALLQFFMVITGGPGTGKTTTVAKLLALICGENENL
PHIALAAPTGKAAAHMARALHRAINGFDAPEAVRRHLLKLEGQTVHRLLKLSPPKMQAAF
DHIRPLPFDVLIVDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSQ
KTVLDGETHQRLAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGD
EGAWALFDRFPDELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAW
RQDAEDFNEAYCSYVRRKMNIPEHLAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQG
SLAAYFADADGFKKVAVSCLPEFEPAFAMTVHKSQGSEYREVWLLPPSDAPSDEGDDALS
GLSKELLYTAITRAREKFVFFGGKKTFCQAVNTVKVRQTALDSMLERVFSQE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcagacggcatttcgacaaggaatacgatggaactgcagacagatgaatttgcc
caagcggcggcaagggcggcaatccgttttttggaacgctatgcgggttcgggcaacgaa
gtgcttgcaaactgtaccgaacgcctgtttcaggcattgcaaaacggtcattcgtttatc
cgtttgagcggggacgaggctgacgcgctgtcggcactcgcacccgtggtcggaacatcc
gccgcgcctttgattttggaaggcagaaggctgtttttgggcaggatgtggcagttggaa
tacgatttggctgccgaaataaaacgcttggcggcagccggcacgtccgcccccgacgcg
gcaggcgcgcggcaaaacctcgcaaaatggtttcaaggcgcgggaagcgaaggacagcgc
gatgcggccgccttggcactgttgcagttttttatggtgattaccggagggccgggaacg
ggcaaaacgacaacggttgccaaactgctggcactgatttgcggtgaaaacgaaaatctt
ccccatatcgcgcttgccgcaccgacgggcaaagcggcggcacatatggcgcgcgcactg
caccgtgcaatcaacggttttgacgcgccggaggccgtccgccgccatttgctcaaactg
gaagggcaaaccgtccaccgactgcttaagctgagcccgcccaaaatgcaggcggcgttc
gaccatatccgtccgctgccgttcgacgtgctgattgtcgatgaagcctccatgttggat
accgcattgatgctgcaacttttgaaagcggtcaaaaccggcgcgcgcgtgattctgctg
ggcgatgaaaaccagctcccgtccgtcggaatcggggcggtgctgtccgttttgtcgcaa
aaaaccgttttggacggagaaacgcaccaaaggctggccggtttccttccggaacacggt
ttcagcgtcagcgcaaatccgcccgtgttggcgcaaaacaccgcccatctgtcgttcagc
caccgcttcggcgacaacagcggcatcggctgccttgcccgtgccgccgtatcgggcgat
gaaggggcgtgggcattgtttgaccggtttccggacgaactggaacattcggaatgcagt
ccgaatgctcgggtcgaaaggttgtaccgggcgcacaaagcctattggcaggcggtaaaa
gacggcaatatcgaagccgcatacgcaggcatctcggatatcgtggttctggcagcttgg
cggcaggatgcggaagacttcaacgaagcctattgcagctatgtacgccgcaaaatgaac
ataccggaacatttggcctatttcgccggagagccgattatgatcagacagaacgactac
gcgcttgagctgttcaacggcgacatcggactgattatggaagatgtcggacggcagggc
agccttgccgcctattttgccgatgcggacggatttaaaaaggtagcggtaagctgcctg
cccgaatttgaacccgcattcgccatgaccgtccacaaaagccaaggttcggaatatcgg
gaagtctggctgctgccgccttccgacgcaccttcggacgaaggggacgatgcattgtcc
ggattgagtaaggagctgttatataccgctattacccgcgccagggaaaaattcgtattt
ttcggcggcaaaaagacattttgtcaggcggtaaacaccgtcaaagtccgtcagacggcg
ttggacagtatgcttgagcgggtattttcacaagaataa

DBGET integrated database retrieval system