KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0849Help
Entry
NGTW08_0849       CDS       T01927                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ngt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(827277..827897)
Genome map
AA seq 206 aa AA seqDB search
MMNSKKQDAFQRLIGALKVLPNVGPKSAQRMAYHLLQQKRKEAEELVDALQTALRQVRHC
ARCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNIEAANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLDGGEIEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattccaaaaaacaggatgcattccaacgcctgatcggtgcgctgaaagtattg
cccaacgtcgggccgaaatcggcacagcggatggcgtaccatctgttgcagcaaaagcgc
aaagaggctgaagagctggtggatgccttacagacggcattgaggcaggttcgccattgc
gcaaggtgcaatacattttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatagaagcggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctggacggcggggaaatcgaa
gaaatcattatcgcgaccgcctttaccgcagaaggcaatgccacagcgtatgtcctgtcc
gagtttttcaaaaacctgccttacaaggtcagcaggctgtcgcagggcatcccattgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacggcgtctg
attaaagaaggcggggcgtaa

DBGET integrated database retrieval system