KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0900Help
Entry
NGTW08_0900       CDS       T01927                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGTW08_0900 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGTW08_0900 (glk)
   00052 Galactose metabolism
    NGTW08_0900 (glk)
   00500 Starch and sucrose metabolism
    NGTW08_0900 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NGTW08_0900 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NGTW08_0900 (glk)
   00524 Butirosin and neomycin biosynthesis
    NGTW08_0900 (glk)
Enzymes [BR:ngt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NGTW08_0900 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(871142..872128)
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKHADYPRLVADIGGTNARFALETAPCVIEKVAVLPCKEYDTVTDAVRAYLNQSG
ATGVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQALGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSPAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYRHVSAERFLSGAGLSLIYETLAAKQKAEPAKLMPSEITEKALNCESPLCRQ
ALDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRMLDYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGIAGAAAALGNHLKNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacacgccgattacccgaggctggttgccgacatcggcggc
acaaacgcccgtttcgcattggaaaccgcgccgtgcgtgattgagaaagtcgccgtcctg
ccgtgtaaggaatacgacacggttaccgacgcggtgcgtgcctatctgaaccaaagtggt
gcaacgggcgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcaggctttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaattcgcccccaaggccgtt
atcggccccggtaccggcttgggcgtgagcggattggtgcacagccccgcaggctgggtg
gcgttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgttg
atttggcagtacgccaaaaacaaataccgccacgtttccgccgaacgtttcctcagcggc
gcaggtttgagcctgatttatgaaacgctggcggccaagcagaaagccgaaccggcaaaa
ctgatgccgtctgaaatcaccgaaaaggcattaaattgcgaatcgcccctgtgccggcag
gcattggacattttctgcgcgatgctgggcacggtcgcttccaacctcgccctgactttg
ggcgcgcgcgggggcgtgtatttgtgcggcggcattatcccgcgaatgttggattacttc
aaaacctcccccttccgcagccgctttgaaaacaaagggcgttttgaagcctaccttgcc
gcgattcccgtttatgtcgtcttgagcgaatttccgggtattgccggcgcggcggcggcg
ctcggcaaccacctgaaaaacgtctaa

DBGET integrated database retrieval system