KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1062Help
Entry
NGTW08_1062       CDS       T01927                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGTW08_1062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGTW08_1062
   00020 Citrate cycle (TCA cycle)
    NGTW08_1062
   00620 Pyruvate metabolism
    NGTW08_1062
Enzymes [BR:ngt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NGTW08_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041536..1043098
Genome map
AA seq 520 aa AA seqDB search
MSIVEIKVPDIGGHESVDIIAVEVKAGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGAAAAEAAPAAAAEAQPAPAAAGGATVQVAVPDIGGHTDVDV
IAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGSAIIEVETA
GSAAAAPAPAAQAAAPAAVPTSASPAAAKIDEAAFAKAHAGPSARKLARELGVDLGQVKG
SGLKGRIMGDDIKAFVKSVMQGGAAKPAAAGASLGGGLDLLPWPKVDFSKFGNVEVKELS
RIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWEREGVKLSPLAFIIKASV
SALKAFPEFNASLDGDNLVLKNYFNIGFAADTPNGLVVPVIKDVDQKGLKQISQELTELS
KKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGVCKSQIKPVWNGKEFA
PRLMCPLSLSFDHRVIDGAAGMRFTVFLANLLKDFRRITL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccccgatatcggcggtcacgaaagcgtcgacatcatc
gccgtagaagttaaagcgggcgacaccatcgccgttgacgacaccctgattacactggaa
accgacaaagccacgatggatgtgcctgccgatgcggccggtgtcgtgaaagaagtaaaa
gtcaaagtcggcgacaaaatctccgaaggcggcgtaattttgaccgttgaaaccggtgcc
gccgctgccgaagccgccccggctgctgccgccgaagcacaacctgcacccgctgccgca
ggcggtgcaaccgttcaagtagccgttcccgatatcggcggccataccgatgtagatgta
atcgccgttgaaatcaaagttggcgacaccgttgccgaagacgacacgctgattactttg
gaaaccgataaagcgacaatggacgtaccttgtaccgctgccggtgtcgttaaagccgta
ttcttaaaagtcggcgacaaagtgtccgaaggctctgccattatcgaagtggaaaccgcc
ggctctgccgcagcagctcctgcgcctgccgctcaagctgccgcacccgccgccgtgcct
acatctgcctcgcctgccgctgccaaaatcgatgaagccgctttcgccaaagcacacgcc
ggtccttccgcacgcaaactggcgcgcgaattgggcgtggatttgggccaagtcaaaggt
agcggcttgaaaggccgtatcatgggagacgacatcaaagcctttgtgaaatccgtaatg
cagggcggcgcggcaaaacctgccgcagccggcgcatctttgggcggcggtctggacttg
ctgccgtggcctaaagtggacttctccaaattcggcaatgtcgaagttaaagaattgtcc
cgcattaagaaaatctccggtcaaaacctgtcccgcaactgggtggtgattccgcacgtt
accgtacacgaagaagcggatatgaccgagctggaagaattccgcaaacagctgaacaaa
gaatgggaacgcgaaggcgtgaaactgtccccgttggcgttcatcatcaaagcctccgtt
tccgcgctgaaagccttccccgaattcaacgcttctttggacggcgacaacctggtgctg
aaaaactacttcaacatcggtttcgcagccgatacgccgaacggcttggttgttcccgtc
atcaaagacgtggatcaaaaaggcttgaaacaaatcagccaagaattgaccgaattgtcc
aaaaaagcccgcgaaggcaagctcaaaccgcaagaaatgcaaggcgcgtgctttaccatt
tccagcttgggcggcatcggcggcacaggtttcacgccgattgtgaacgctcccgaagtc
gctatcttgggcgtgtgcaaatcccaaatcaaaccggtttggaacggcaaagagtttgcc
ccgcgcctgatgtgcccgttgagcctgtccttcgaccaccgcgtcatcgacggtgccgcc
ggtatgcgcttcaccgtattcctggcgaacctgttgaaagacttccgccgcattacctta
taa

DBGET integrated database retrieval system