KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1235Help
Entry
NGTW08_1235       CDS       T01927                                 

Definition
DhpS
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGTW08_1235
Enzymes [BR:ngt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NGTW08_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1216548..1217399)
Genome map
AA seq 283 aa AA seqDB search
MARHVWRAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRSGADFVPPEEEWARVEPVLAEAAGWGVPVSLDTRRTVVMEKALALGGIDIIND
VAALTDEGAVELLARQADTGICLMHMRGLPETMQDNPKYQDVVGEVARYLKTRSETCVAA
GIAPQRITLDPGFGFGKNLQHNIALMRHLPELMAETGLPLLIGVSRKSMIGELTGEADAA
ARVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGVNR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacgtttggcgggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggcatcgtgaatctcacgcccgattctttttccgacggtggcgcgtattcgcaaaac
gcccaaacagctttggcgcatgccgaacggcttttgaaagagggtgcggacattctcgac
atcggcggcgaatcgacgcggtcgggtgcggatttcgttccgcccgaagaagaatgggcg
cgggttgagcctgtattggcggaagcggcggggtggggcgttcccgtcagtttggacacg
cgccgcacggtggttatggaaaaggcgttggcactcggcggcatcgatattatcaatgat
gtggcggcgttgaccgacgaaggtgcggtcgaattgctggcgcgccaggcggacacgggc
atttgcctgatgcatatgcggggcttgcccgaaaccatgcaggacaatccgaaatatcag
gatgtggtcggcgaagtggcacgttatctgaaaacacggtcagaaacctgtgtcgcggca
ggcatcgcgccgcaacggattacgctcgacccgggtttcggcttcggcaagaacctgcaa
cacaatatcgcactgatgcggcatttgcccgaattgatggcggaaaccggtttgccgctg
ctgatcggtgtgtcgcgcaaaagcatgataggtgagctgaccggtgaggcggacgcggcg
gcgcgcgtacacggcagcgtggcagcggctttggcttccgtggcacgcggagcgcaaatc
gtgcgcgtgcacgatgtgaaggcgacggcggacgcgttgaaggtgtgggaagcgttgggc
gtgaaccggtaa

DBGET integrated database retrieval system