KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1299Help
Entry
NGTW08_1299       CDS       T01927                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NGTW08_1299
Enzymes [BR:ngt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     NGTW08_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1281368..1283071)
Genome map
AA seq 567 aa AA seqDB search
MSGRQGFPGRIIKFFSHRLAVRKPVCRILSKECCMSDEKLEQNGLSRRSFLGTAAASGAG
IAGAGLLGLAGCSKDGEQAAANASGAAPVAKAQGESKPGQLSSEVGPGELDQYYGFLSGG
QSGEMRLIGLPSMRELMRIPVFNMDSATGWGRTNESLKVLNGNITEETRKFLKDGGLRCY
PNGDLHHPHLSFTDQTYDGRYAYANDKANNRVCRVRLDVMKADKIIDIPNDSGIHGLRPQ
RYPKTGYVFANGEHITPVSGVGKLDDAKTWNAVYTAIDGETMEIAWQVLVDGNLDNGDAD
YQGKYSFATCYNSERALTVQGASSNEQDWCVVFDLKAIEEGIKAGDFKEVNGVKMLDGRA
EAKSKYTRYIPVPNSPHGCNASPDGKYIMPNGKLPPTVTVLDVSKLDDLFAGKIKERDVV
VAEPQLGLGPLHTAFDGRGNAYTTLFIDSQMVKWNIDDAIKAYKGEKIDPIKQKLDVHYQ
PGHNHTTMGETKEADGQWLVSLNKFSKDRFLNAGPLKPECDQLIDISGDEMRLVHDNPTF
AEPHDLCLVAASKLNPGKTWDRKDPWF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaggcaggcagggtttccccggaaggataataaaatttttttcccatcggcttgcc
gtccgaaaaccggtttgccgtattttatccaaggagtgttgtatgtcagacgaaaaatta
gaacaaaacggcttgagccgtcgttcgttcttaggtacggccgccgcttccggtgcaggt
attgccggtgcgggcctgttgggtttggcgggttgctctaaagacggcgaacaggctgcc
gctaacgcttccggcgcggctcccgtcgccaaggcgcaaggggaatccaaacccggccaa
ctgtcttccgaagtcggtccgggcgaactcgatcaatattacggtttcctttccggcggc
cagtccggcgagatgcgcctgatcggtctgccttctatgcgcgaactgatgcgtatcccc
gtgttcaatatggacagcgcgaccggttggggacgcaccaatgagagcttgaaagtcctc
aacggcaatattaccgaagaaacccgtaaattcttaaaagacggcggcctgcgctgctac
cccaacggcgacttgcaccacccgcacctgtcgtttaccgaccaaacttatgacggccgc
tatgcctatgccaacgacaaggcaaacaaccgcgtctgccgcgtgcgtttggatgtgatg
aaggccgacaaaatcatcgacatccctaatgattcaggtattcacggtctgcgtccgcaa
cgttatccgaaaaccggttatgtttttgccaacggcgaacacattacccctgtcagcggt
gtaggcaaactggatgatgcgaaaacctggaatgcagtgtacaccgccatcgacggcgaa
accatggagatcgcatggcaagtattggttgacggtaacctggacaacggcgatgccgac
tatcaaggcaaatattcttttgccacctgctacaactccgagcgcgcgctgaccgtacaa
ggtgcgtcttccaacgagcaggactggtgcgtcgttttcgacctgaaagccatcgaagaa
ggcatcaaagcgggcgacttcaaagaagttaacggtgtgaaaatgctggacggccgcgct
gaggccaaatccaaatacacgcgttatatccctgtgccgaactctcctcacggctgtaac
gcaagccctgacggtaaatacatcatgcccaacggtaaactgcctccaaccgttaccgta
ttggatgtcagcaaactggacgatttgttcgccggcaaaatcaaagagcgcgatgtggtc
gtagccgaaccgcaactgggtctcggcccgttacacactgcattcgacggtcgcggcaat
gcttatacgacattgtttatcgacagccaaatggtgaaatggaatattgacgatgcgatc
aaagcctacaaaggcgagaaaatcgatccgatcaaacaaaaactcgacgttcactatcaa
ccgggtcacaaccatacgaccatgggcgaaaccaaagaagccgacggtcaatggctggtg
tccttgaacaaattctccaaagaccgcttcttgaatgccggtcctttgaaacccgagtgc
gaccaattgatcgacatctccggcgacgaaatgcgtctggtacacgacaacccgactttt
gccgaaccgcacgacttgtgtttggttgccgcgtccaaactgaacccgggcaaaacttgg
gaccgcaaagacccgtggttctag

DBGET integrated database retrieval system