KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1473Help
Entry
NGTW08_1473       CDS       T01927                                 

Definition
aldose 1-epimerase (mutarotase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGTW08_1473
   00052 Galactose metabolism
    NGTW08_1473
Enzymes [BR:ngt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NGTW08_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1457584..1457853)
Genome map
AA seq 89 aa AA seqDB search
MPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDAGVYDALATEAQTLPDS
LHWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtccgatataggccgtcccgccgccgtgttgcaagccggacgccgccgtcgtatc
agcatatacagcgaccgcaacggcttggtcatctttaccgccgccccgcaggatttcgcg
cggcacgatgcgggcgtttacgacgcgctggcgaccgaggcgcagacgctgcccgacagc
ctgcattggcccgaattcggcaatatccgtctgaacaagggtgatactagggaggcgacg
attgcttacggcatcgaatccctttcttag

DBGET integrated database retrieval system