KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1656Help
Entry
NGTW08_1656       CDS       T01927                                 

Definition
protein FolA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGTW08_1656
   00670 One carbon pool by folate
    NGTW08_1656
Enzymes [BR:ngt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NGTW08_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621304..1621894)
Genome map
AA seq 196 aa AA seqDB search
MRTQNVWRAQVEIFDAECHKMPSEAFRRHFCGENMLKITIIAACAENLCIGAGNAMPWHI
PEDFAFFKAYTLGKPVIMGRKTWESLPVKPLPGRRNIVISRQADYCAAGAETVASLEAAL
ALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVDLSVEGDAFFPEIDRTHWKEAERTERR
VSSKGVAYTFVHYLKG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaacacaaaacgtatggcgcgcgcaggttgagatttttgacgcagaatgtcataaa
atgccgtctgaagcgttcagacggcatttttgtggagaaaatatgctcaaaataaccata
attgcggcgtgtgcggaaaacctgtgcatcggggcgggcaatgctatgccttggcacatc
cccgaagatttcgcatttttcaaagcctataccttgggcaaacccgtcattatggggcgg
aaaacgtgggaatccctgcccgtcaaacccctgcccggacggaggaacatcgtcatcagc
cggcaggcggattattgcgcggcaggcgcggaaacggtggcaagtttggaggcggcattg
gcattgtgcgccggcgcggaagaagccgtcattatgggcggcgcgcagatatacggacaa
gcgatgccattagcgaccgatttgcggataaccgaagtggatttgtctgtggaaggagat
gcatttttcccagaaatagaccggacgcattggaaagaagcagagcggacggaacgccgt
gtcagcagcaaaggcgttgcatatacattcgtgcattacctcaagggataa

DBGET integrated database retrieval system