KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1687Help
Entry
NGTW08_1687       CDS       T01927                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGTW08_1687 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGTW08_1687 (trpC)
Enzymes [BR:ngt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NGTW08_1687 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1656990..1657772
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILATKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIDSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVLLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEQGQLERFEALAHELGMTVLLELHDETELEKC
RNLTTPLRGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMRARGVHTF
LIGETFMRADDIGAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttgccaccaaggcacaggaagttgccgcccaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgcagaagccgcgcccgtccgcagc
ttcatcgattcgatacgcggcaaacaccgcctaaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaagggttaatccgccccgacttccgccctgccgagattgcc
cgcgcctatgaaaacgccggggcggcgtgtttgtcggtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtattgctgcccgtgctgcgc
aaagacttcatcatcgacgaataccaggtttatcaggcgcgcgcatggggggcggatgcc
gtcctgctgattgccgccgcactggaacagggacaattggaacgctttgaggcgctggcg
cacgaattgggcatgaccgtcctgctcgagctgcacgacgaaaccgaattggaaaaatgc
cgcaacctgaccacgccgttgcggggcgtaaacaaccgcaacctgcggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggcaaggcggatgtggaatttatgcgggcgcgcggcgtgcataccttc
ctgatcggcgaaacgtttatgcgtgccgacgatattggggcggaagtgggcaaactcttc
taa

DBGET integrated database retrieval system