KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1696Help
Entry
NGTW08_1696       CDS       T01927                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGTW08_1696 (ruvA)
Enzymes [BR:ngt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NGTW08_1696 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1665928..1666512
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAASPAADETEDIVSTLLALGYNEREAKAAVKGVPKGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggttatgaagccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaagaccttccgccaactgattaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcgg
gcggttgcagaagaagatgtcaaacgcctctcctccgctccgggaatcggcaaaaaaacc
gccgaacgtatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgcctcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacaacgaacgcgaggcaaaagcggcggtcaaaggcgttccgaaggggacggac
gtgggcgaaggcgtgcgccttgccctgaaaaacctgctgaaataa

DBGET integrated database retrieval system