KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1863Help
Entry
NGTW08_1863       CDS       T01927                                 

Definition
protein PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NGTW08_1863
Enzymes [BR:ngt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NGTW08_1863
    3.5.1.-  
     NGTW08_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825271..1825906)
Genome map
AA seq 211 aa AA seqDB search
MIVSIDVDAQKTFTPLCPDELPVNEGHLIVEELNAQAALADLRVMTKDAHHMAAKWLVGN
PVNMLKPTGLSDADLTWVAHAMVGTRGYELLDGLPSVKEYDYCVWKGVDPELHPYGACFH
DIEEKLSTGLIEWLRCQNTNMVIVGGLATDYCVKTTVLQLLKGGRWQVIVNEAACRGIAP
DTIEAAWQEMRSSGAIILKNAEKIKKYINNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacttttacgcctttgtgtcctgacgaa
ctgcccgtgaacgaggggcatttgattgtcgaggagttaaatgcccaagccgctttggcg
gatttgcgtgtgatgacgaaagatgcgcatcatatggcggcgaaatggcttgtgggtaac
cctgttaatatgttgaagccgacaggtttgtccgatgcggatttgacttgggtggctcat
gcgatggtcggtacgcgcggctatgaattgttggacggtctgccttccgtcaaggaatac
gattattgcgtttggaaaggtgtcgatcccgaattgcatccttacggcgcgtgttttcac
gatattgaggaaaaactgagcactggattgattgagtggctgcgttgtcaaaatacgaat
atggtcattgtcggcggcttggctacggattattgtgttaaaacaacggttttgcagtta
cttaaaggcggtcgttggcaggttatcgtgaatgaagcggcttgtcggggtattgcgccc
gataccattgaagcagcgtggcaggaaatgcgttcttcgggtgcgataattttgaaaaac
gccgaaaaaattaaaaaatatattaataatcaataa

DBGET integrated database retrieval system