KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1883Help
Entry
NGTW08_1883       CDS       T01927                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:ngt00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1842076..1843413)
Genome map
AA seq 445 aa AA seqDB search
MIPLPKCRPNRSDGICFAGNRKMFQWLYDVLWLLAPIWIRRYLDKRSGSAPAYRAHRDER
FGKPHPNPVTGAVWIHAVSVGETRAAQPLIRELRRRFPDAPLLMTQMTPTGRETAQVLFP
DAQCRYLPYDKKTWVRQFLREHRPMFGILMETEIWPNLMKECRRAGVPLFLANARLSEKS
LNGYLKVRRLIRPAAASLTGCLAQTEADAARLAKLGAASVQVCGNTKYDLMPSEDMKTLA
GQFEKRIGGRPVAVCGSTRVYRGEDEAEKLLAAWQQYRGDALLAVVPRHPEHFQTTFETA
KRFGFKVQRRSDGLPVEPDTQVWIGDSMGELYAYYLCADVAFVGGSLVGSGCQNIIEPLS
CGVTTIFGFSTYNFSEACRHALASGAAVQVESADAWREAVEKNLSGEGGGMQMQARVDGF
IAQHRGAGARIAEAVREAVCGHRGR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgttgccgaaatgccgtccgaaccgttcggacggcatttgttttgcaggaaat
agaaagatgttccaatggctttatgatgtattgtggctgcttgcgccgatatggatacgg
cgttatttggacaaacgctccggaagtgccccggcataccgggcgcatagggacgagcgt
ttcggcaagccgcatccgaatcccgttaccggcgcggtttggatacacgccgtttcggtc
ggagaaacgcgtgccgcccagcccttgatacgcgagttgcggcggcgttttcccgatgcg
ccgctgctgatgacgcagatgaccccgacgggacgggaaaccgcgcaagttctgtttccc
gatgcgcaatgccgctatcttccgtatgacaaaaaaacgtgggtacggcagtttttgcgc
gaacaccgcccgatgttcggcattttgatggaaaccgaaatctggcccaatctgatgaag
gaatgccggcgagcgggtgtgccgctgtttttggcgaatgcgcggctgtcggaaaaatcg
ctgaacggttatctgaaagtccgccgcctgatccgtcccgcagccgcttcgctgacgggc
tgtctggcgcagacggaggcggatgcggcgcggttggcgaaattgggcgcggcatccgtg
caggtgtgcggcaataccaaatacgacctgatgccgtctgaagacatgaaaacgctggcg
gggcagtttgaaaaacgcatcggaggccggccggttgccgtgtgcggcagcacgcgcgtt
tatcggggcgaagacgaggcggaaaaactgctggcggcgtggcaacaatatcgcggcgat
gccctgctggccgtcgtgccgcgccatcccgagcattttcagacgacatttgaaacggcg
aaacgcttcgggtttaaggttcagcggcgcagcgacggtttgccggtcgaacccgatacg
caggtgtggataggcgacagtatgggcgagctgtatgcgtattacctgtgcgccgatgtc
gcttttgtcggcggcagtctggtcggttcgggctgtcagaacatcatcgaaccgctttcc
tgcggcgttacgacgatattcggcttttcgacctacaatttttccgaagcctgccggcac
gccttggcatcgggtgcggcggttcaagtcgaatcggcggacgcgtggcgtgaagccgtt
gaaaaaaacttatctggcgaggggggcggaatgcagatgcaggcgcgcgtggacggcttt
atcgcacaacatcgcggagcgggcgcgagaatcgccgaggcggtgcgggaagcggtatgc
ggacatcgggggcgatag

DBGET integrated database retrieval system