KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_1927Help
Entry
NGTW08_1927       CDS       T01927                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ngt00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ngt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1900353..1901273
Genome map
AA seq 306 aa AA seqDB search
MPNPLYRQHIISISDLSREQLECLLQTALKLKAHPRGDLLEGKLIGSCFFEPSTRTRLSF
ETAVQRLGGKVIGFSDGANTSAKKGETLADTARIISGYTDAIVQRHPKDGAARVAAEFSC
VPVINAGDGTNQHPSQTLLDLVTIYETQGRLDKLKIAMAGDLKYGRTVHSLCQALKRWGC
EFAFVSPPSLAMPDYITEELEEADCRYRALGSLEEAAEWADILYMTRVQRERFDEQEFAK
IQGKFNLEASMLARAKPNLRVLHPLPRTDEIHPDVDATPHAYYFEQATNGVYARMAILSL
VLNEEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatccgctttacagacagcacatcatctccatttcggatttgtcgcgcgaacag
ttggaatgcctgcttcagacggcattgaagctgaaggcgcatccgcgcggcgatttgttg
gaaggcaaactcatcggttcgtgctttttcgagccgtccacgcgcacgaggctgtcgttt
gaaacggcggtgcagcgtttgggcggtaaggtcatcggcttttcggacggcgcgaatacc
agtgccaaaaaaggcgaaacgcttgccgataccgcccgtatcatttccggctacaccgac
gcgattgtccaacgccatcccaaagacggcgcggcgcgcgtggcggcggagttttcgtgc
gtccccgtcatcaacgccggcgacggcacgaaccagcatcccagccagaccttgttggat
ctggtaacgatttatgaaacgcaggggcgtttggacaagcttaaaatcgccatggcgggc
gacttgaaatacgggcgcaccgtgcattcgctgtgtcaggcgttgaaacgctggggctgc
gaatttgccttcgtctcgccgcccagcctcgcgatgcccgactacattaccgaagagttg
gaagaagccgactgccgataccgcgccctcggcagtttggaagaggcggcggaatgggcg
gacatcctgtatatgacccgcgtccagcgcgaacgtttcgacgaacaggaatttgccaaa
attcaaggcaaattcaacctcgaagcgtctatgctcgcccgcgccaaaccgaacctgcgc
gtgctgcaccctttgccgcgcacggacgaaatccatcccgatgttgatgctacgccgcat
gcctattatttcgagcaggcgaccaacggcgtttatgcgcgtatggcgatattgtcgctg
gtgttgaacgaagaagtgtga

DBGET integrated database retrieval system