KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_2032Help
Entry
NGTW08_2032       CDS       T01927                                 

Definition
protein CcpR
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2012533..2013663)
Genome map
AA seq 376 aa AA seqDB search
MALSSLLAACGGQEKSAAGDASPASETEAASQVQASEAVPSASSASPEDQDLLKRAQGVF
QPLPTVEEMQKIRPFTEEQVKLGHQLWYEPRLSKGNTVSCNSCHNLASAGVDNMPTSQGH
KGQFGGRNSPTALNAALLGSQFWDGRAADVEEQAGGPLVNPVEMANDSQEAAAAKIAKVP
EYQEMFKKAFPEDGAVSFKNITTALGAFERTLLTPTKWDEYLKGNVNALSEQERKGVRAF
MDNGCIACHNGVNLGGTTFQKFGLVQGPYWKFIEDPKRDKGRADVTKKTEDEFFFRVPGL
RNVAKTYPYFHNGSVWELDKAVTIMGKAQLGKDIPKEDVDNIVVFLNALSGNVSESARTM
PELPLTAPMESKPDNK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttggcattgtcttcactgttggcggcatgcggcggtcaggaaaagtctgcggcaggcgat
gcttctcctgcttccgagaccgaagcggcttcccaagtacaggcctcggaagccgttcct
tccgcttcatcggcctcgcccgaagaccaagaccttttgaaacgcgcgcaaggtgtattc
caacctttgccgactgtcgaagaaatgcagaaaatccgtccgtttaccgaagaacaggtc
aaactcggacaccaactctggtatgaaccacgcctttccaaaggcaataccgtaagctgc
aactcttgccacaaccttgcttccgccggtgtggacaatatgccgaccagtcaggggcac
aaagggcagttcggcggacgcaactcgcctaccgcattgaatgctgcgctgctgggcagc
cagttttgggacggacgtgccgccgatgttgaagaacaggctggcgggcctttggtgaat
ccggtggaaatggcgaatgattcgcaagaggcggctgcagccaaaatcgccaaagttccc
gaatatcaagaaatgtttaaaaaagcttttcctgaagacggcgcggtttcgtttaaaaac
atcactaccgcattgggtgcgtttgagcgtaccctgctgacgccgaccaaatgggacgaa
tacctcaaaggcaacgtcaacgccctgagcgaacaggaacgaaaaggcgtgcgcgcgttc
atggacaacggctgtattgcctgccacaacggtgtcaaccttggaggcacgaccttccag
aaattcggtctggtccaagggccgtattggaaattcattgaagatccgaaacgcgacaaa
ggccgtgctgacgtaaccaaaaaaaccgaagacgaatttttcttccgtgttccggggttg
cgtaacgtggctaaaacttatccgtatttccacaacggcagcgtgtgggagctggataag
gcagttaccatcatgggtaaggcgcaattgggtaaagacattccgaaagaagatgtggat
aacatcgtcgtattcctgaatgcactttccggcaatgtttccgaatcagcgcgcacgatg
ccggaactgcccctgaccgcaccgatggaatctaagccggacaacaaataa

DBGET integrated database retrieval system