KEGG   Nitrobacter hamburgensis: Nham_0063Help
Entry
Nham_0063         CDS       T00348                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nham_0063
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nham_0063
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nham_0063
Enzymes [BR:nha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nham_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(74997..76241)
Genome map
AA seq 414 aa AA seqDB search
MNSLPNSFRSGPDARGHFGIFGGRFVAETLMPLILDLEKAYTEARADAAFQRDMAGYRKD
YIGRPSPLYFAERLTEHLRDISAASGRAGGAKVYLKREELNHTGSHKVNNVLGQILVARR
MGKKRIIAETGAGQHGVATATLCARFGLECVVYMGAVDVARQEPNVIRMEMLGAKVVPVQ
SGTRTLKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVRDFQSIIGDETRAQMQEAE
GRLPDSLIACIGGGSNAMGLFHPFLDDSSVEIFGVEAAGHGLDKLHAASLTGGRPGVLHG
NRTYLLMNDDGQIQDAHSISAGLDYPGIGPEHSWLHETGRVTYLSATDEEALSAFQLLSR
LEGIIPALESAHAIARVVELAPERPKDHLMVVNLSGRGDKDVPQVGDILKGRRK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaattctctccccaattccttccgctccggtcccgatgcgcgcgggcacttcggcatt
ttcggcggccgcttcgtcgcggaaacgctgatgccgctgatcctcgatctggagaaggcc
tatactgaggccagggccgatgccgcgttccagcgcgacatggccggctatcgcaaggac
tacatcggccgtccgtcgccgctgtatttcgccgagcgtctgaccgagcatcttcgggac
atctccgcggcttccggccgcgccggcggcgcgaaggtctacctcaagcgcgaagagctc
aatcacaccggttcgcacaaggtcaacaatgtgctcggccagattctggtggcgcggcgc
atgggcaagaagcggatcatcgccgagaccggtgccggccagcacggcgtggcgaccgcg
acgctatgcgcgcgcttcggtctcgaatgcgtggtctacatgggcgcggtggacgtggcg
cggcaggagcccaacgtcatccgcatggaaatgctgggcgccaaagtggtgccggtgcag
tccggtacccgcacgctgaaggatgcgatgaacgaggcgctgcgcgactgggtcaccaac
gtgcataacaccttctattgcatcggcacggtggcggggccgcatccctatccgatgatg
gtgcgcgacttccagtcgatcatcggcgacgagacgcgcgcacagatgcaggaggccgag
ggacggctgccggattcgctgatcgcctgcatcggcggcggctccaatgcgatgggactg
ttccatcccttcctcgacgattcctcggtggagattttcggcgtcgaggcggcgggccac
ggcctcgacaagctgcacgcggcctcgctcaccggggggcggcccggcgtgctgcacggc
aaccgcacctatcttttgatgaatgacgacggccagatccaggacgcgcattcgatttcc
gcaggattggattatcccggcatcgggccggaacattcatggctgcacgaaaccggccgc
gtgacatatctttccgcgaccgacgaggaagcgctcagcgcgtttcagttgctgtcgcgg
ctggagggcatcatcccggcgctggaatcggcgcatgcgatcgcgcgcgtcgtcgaactc
gcgcccgaacggccgaaggatcacctgatggtggtcaatctctcgggccgcggcgacaag
gacgtgccgcaggtcggcgatatcctgaagggcagaagaaagtga

DBGET integrated database retrieval system