KEGG   Nitrobacter hamburgensis: Nham_0262Help
Entry
Nham_0262         CDS       T00348                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nham_0262
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nham_0262
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nham_0262
Enzymes [BR:nha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nham_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
291372..292790
Genome map
AA seq 472 aa AA seqDB search
MTHYISTRGETQKLRFCDVMLAGLARDGGLYVPEVWPQLTPDTIAGFFGRPYWEVAVEVI
RPFVAGDISDADLGRMANEAYATFRHPAVVPLDQIGPNQFMLELFHGPTLAFKDVAMQLL
SRLMDHVLAQRGRRTTIVVATSGDTGGAAVDAFANRANVDLIVLFPDGRISEVQRRMMTT
TGASNVHALAVKGTFDDCQAIVKGLFNNHRFRDEVSLSGVNSINWARIVAQVVYYFTSAV
ALGAPARTVDFTVPTGNFGDIFAGYVAKKMGLPVRCLRIAANVNDILVRTLKTGIYEVRE
VRATASPSMDIQVSSNFERLLFEATGRDAAQVRALMASLAQSGRFVLPDPVLAEIRRDFD
VGRSDETETAAAIRAAWREAGDLVDPHTAVALAIADRDTSDSKIPNIVLATAHAAKFPDA
VEAACGARPQLPAWLDGLMTRPERITVVNNDQVEIERFVLSVSRAAKHGVAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcattatatttcgacccggggcgaaacccagaaactcaggttctgcgatgtgatg
ctggccgggctcgcccgcgacggcggtctctatgtgcccgaggtctggccgcagttgacg
cccgataccatcgcgggctttttcggccggccgtattgggaggtcgccgtcgaggtcatc
aggccgttcgtggccggagatatctccgatgccgatctcggccgcatggccaatgaggcc
tatgcgacgttccggcatccggcggtggtgccgctcgaccagatcggccccaatcaattc
atgctggaactgtttcacggtccgacgctcgcgttcaaggacgtggcgatgcagcttctg
tcgcggctgatggatcacgtcctggcgcaacgcggccggcgcacgaccatcgtggtggcg
acctcgggcgatactggtggcgccgcggtcgacgcgttcgccaaccgcgccaatgtcgac
ctgatcgtgctatttccggacggccgcatctccgaggtgcagcggcggatgatgacgacg
acgggcgcgtccaacgttcacgcgctagcggtcaagggcaccttcgacgactgtcaggcg
atcgtgaaggggctgttcaacaaccaccgcttccgcgacgaggtgtcgctctccggcgtc
aactcgatcaactgggcgcggatcgtcgcgcaggtggtgtattatttcacctcggcggtc
gcgctcggcgcgccggcgcgcaccgtcgattttaccgttccgaccggtaatttcggcgac
atcttcgccggttacgtcgcgaagaaaatgggcctgccggtgcgctgcctgcgcatcgcc
gccaacgtcaacgatatcctggtgcgcacgctgaagaccggcatctacgaggttcgcgag
gttcgcgccaccgcctcgccgtcgatggatatccaggtttcgtcgaacttcgagcggctg
ctgttcgaggcgacgggtcgcgacgccgcgcaggtacgcgcgctgatggcatcgctcgca
cagtccggacgcttcgtgctgccggatcccgtgctggccgagatccgccgcgatttcgat
gtcgggcgcagcgacgagaccgagaccgcggccgcgatccgcgcggcgtggcgcgaggcc
ggcgatctcgtcgatccccataccgcggtggccctcgcgatagccgatcgcgatacctcc
gactccaaaattcccaacatcgtgctggcgacggcgcatgccgcgaagtttcccgatgcg
gtcgaggccgcttgcggcgcgcggccgcaattgccggcgtggctcgacgggttgatgacg
cggcccgagcggatcacggttgtgaacaacgatcaggtagaaatcgaacggttcgtgctg
tccgtcagccgcgccgccaagcacggagttgccggatga

DBGET integrated database retrieval system