KEGG   Nitrobacter hamburgensis: Nham_0285Help
Entry
Nham_0285         CDS       T00348                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nha  Nitrobacter hamburgensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nha00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nha00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
316402..317691
Genome map
AA seq 429 aa AA seqDB search
MDRIRIVGGNKLNGTIPISGAKNAALPLMIAALLTEETLILDNVPRLADVAQLQRILGNH
GVDIMSAGKRSGDHEYQGQTLHISAANVIDTTAPYELVSKMRASFWVIAPLLARMHETKV
SLPGGCAIGTRPVDLLIMALEKLGAEVAIDGGYVIAKAPGGLTGAEVDFPKVTVSGTHVA
LMAATLAKGTTVITNAACEPEIVDVADCLNKMGARVSGAGTPRIVIEGVSRLGGARHTVL
PDRIETGTYAMAVAMTGGDVLLRGARPELLQSALDVLTEAGAVITPNNEGIRVARNGAGI
NPVIVSTAPFPGFPTDLQAQLMALMTRAKGSSHITETIFENRFMHVQELARFGARIHLDG
ETATIEGIGILRGAPVMATDLRASVSLVIAGLAAEGETMVNRVYHLDRGFERLEEKLSGC
GASIERISD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattcgcatcgtcggcggcaacaagctcaacggcaccattccgatttccggc
gcgaaaaacgcggcgctgcctttgatgatcgctgcgctgctgaccgaggagacgctgatt
ctcgacaatgtgccgcggctggccgacgtcgcgcagttgcagcgtatccttggtaaccac
ggcgttgacatcatgtcggcgggcaagcgctccggcgatcacgagtatcagggacagacc
ctgcacatttcggccgccaacgtcatcgacaccacggcgccgtacgaactggtctcaaag
atgcgggcgagtttctgggtgatcgcgccgctcttggcgcggatgcatgaaaccaaagtt
tcgctgcccggcggctgcgcgatcggcacccgcccggtcgatctcctgatcatggcgctg
gaaaagctcggcgccgaggtcgcgatcgacggcggctatgtgatcgcaaaggcccccggc
ggcctgacgggcgccgaggtggatttccccaaggtgaccgtgagcggcacccacgtcgcg
ctgatggcggcaacgctggcgaagggcaccaccgtcatcaccaacgcggcctgcgagccg
gagatcgttgatgtcgcggattgtctgaacaagatgggggcgcgcgtttccggtgcgggc
acgccgcgaatcgtcatcgagggcgtcagcaggctcggtggtgcgcggcacaccgtgctg
cccgaccggatcgagaccggcacctatgcgatggcggtggcgatgaccggtggcgacgtg
ctgcttcgcggcgcgcggccggagctgttgcaatccgcactcgacgtgctgaccgaggcg
ggcgctgtcatcacgccgaacaacgaaggcattcgagtggcccgaaacggcgccggcatc
aatccggtgatcgtctcgaccgcgccgttcccaggctttccgaccgaccttcaggcgcaa
ttgatggcgctgatgacacgcgctaagggctcgtcccacattaccgagaccatcttcgaa
aaccggttcatgcacgtgcaggaactggcgcggttcggggcacgcatccatctcgacggc
gagaccgccaccatcgagggcatcgggatacttcgcggcgcgccggtcatggcgacggat
ttgcgcgcctcggtgtcgctcgtgattgcggggctcgccgctgaaggcgagaccatggtc
aaccgcgtctaccatctcgaccgcggcttcgaacgactcgaggaaaagctgtcggggtgc
ggtgcctcgatcgaacggatcagcgactag

DBGET integrated database retrieval system