KEGG   Nitrobacter hamburgensis: Nham_0377Help
Entry
Nham_0377         CDS       T00348                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
nha  Nitrobacter hamburgensis
Pathway
nha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nham_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABE61268
JGI: Nham0377
UniProt: Q1QR79
Position
415847..416401
Genome map
AA seq 184 aa AA seqDB search
MGVSDINKFLGVLLGTCIVLLVMNFVAQAIFAPVVPAKPGFKIDVKVKQEPAAADKEAKP
AAEVPIGKLLQTASAEEGAAAAKKCAACHTFEKGGPNRVGPNLYGIVGEPRGQGRGFNFS
AAMKAKGGTWTFDELNKFLTNPKGYIPGTAMSFAGVPKDSERADIIAYLNKNSDKPEPLP
AASK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtttccgatatcaataaatttctcggcgtgctcctgggcacgtgcatcgttctg
ctggtcatgaatttcgtcgcccaggcgattttcgcgcctgtcgtgccggcgaagcctggt
ttcaaaattgacgtcaaggtcaagcaggaaccggctgcggctgacaaggaagccaagccg
gcggcggaggtgccgatcgggaagctgctgcaaaccgcatcggccgaggagggcgccgcc
gcagccaagaagtgcgccgcctgccataccttcgagaagggcggacccaaccgggtcggc
cccaatctctacggcatcgtcggcgagccgcgcggccagggccgcggattcaacttctcg
gcggccatgaaggccaagggcggcacctggaccttcgacgagctgaacaagttcctcacc
aatccgaagggatacatccccggcaccgccatgtcgttcgccggcgtgcccaaggacagc
gagcgtgccgacatcattgcctatctgaacaagaactccgacaagccggagccgctgccg
gccgcctcgaagtag

DBGET integrated database retrieval system