KEGG   Nitrobacter hamburgensis: Nham_0518Help
Entry
Nham_0518         CDS       T00348                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00330  Arginine and proline metabolism
nha00332  Carbapenem biosynthesis
nha01100  Metabolic pathways
nha01130  Biosynthesis of antibiotics
nha01230  Biosynthesis of amino acids
Module
nha_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nham_0518
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Nham_0518
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Nham_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABE61408
JGI: Nham0518
UniProt: Q1QQT9
Position
573119..574258
Genome map
AA seq 379 aa AA seqDB search
MTSLHLKKFRRIVVKVGSSLLIDSDAGEVRAAWLSALADDIAGLHGEGRDVLIVSSGSIA
LGRSKLKLPRGPLKLEESQAAAAVGQIALARIWSKVLGDHGIGAGQILVTLQDTEERRRY
LNARSTIAKLLDWRAVPVINENDTVATNEIRYGDNDRLAARVATMASADLLILLSDIDGL
YDAPPHLNPDAKLIPVVKRVTADIEAMAGSAASELSRGGMQTKIEAAKIATTAGTHMLIA
SGKIEHPLRAVMDGGRCTWFMTPANPVTARKRWIAGSLEPKGTLTIDAGAVAALRAGKSL
LPAGVIRVDGQFARGDAVIVRGPNTHEIGRGLVAYDAVDAEKIKGRSSCDAAQILGISGR
AEMIHRDDLVVGGPRGGAG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgcatcttaagaaattccgacgtatcgtcgtcaaggtcggctcgtcgctg
ctgatcgattccgatgccggcgaggtgcgcgcggcgtggctgtcggcgctggccgacgat
atcgccgggcttcatggcgaggggcgcgacgtgctgatcgtctcgtccggctcgatcgcg
ctcggccgcagcaagctcaagctgccgcgcggcccgctgaagctggaggagagtcaggcc
gccgccgccgtcggacagatcgcgctggcgcggatctggtcgaaggtgctgggcgatcac
ggcatcggcgcggggcagattctggtgaccttgcaggacaccgaggaacgtcgccgctac
ctcaatgcgcgctcgaccatcgcaaaactgctcgactggcgcgcggtccccgtcatcaac
gagaacgacacggtggccaccaacgaaatccgctacggcgacaacgaccgtctcgccgcg
cgcgtcgccaccatggcgagcgccgatttgctgatcctgttgtcggatatcgacgggctc
tacgacgcgccgccccatctcaatccggatgcgaaactgattccggtggtgaagcgcgtc
accgccgacatcgaggcgatggcgggcagcgccgcgtccgaactgtcgcgcggcggcatg
cagaccaagatcgaggcggcgaagatcgcaaccaccgccggcacgcacatgctgatcgcc
tccggcaagatcgagcacccgctgcgggccgtcatggacggcggccgctgcacctggttt
atgacgccggcaaatccggtcacggcgcgcaaacgctggatcgcggggtcgctggagccg
aagggcacgctgactatcgatgccggagcggttgccgcgctgcgcgccggcaagagcctg
ttgccggccggcgtgatccgggtcgatgggcaattcgcacgtggcgatgccgtcatcgtg
cgcggtcccaatacgcatgagatcggccgcggcctcgtcgcctacgatgccgtggacgcg
gagaagatcaagggacgctcgtcctgcgatgcggcgcagatcctcggcatcagcggccgg
gccgaaatgatccatcgcgacgatctcgtggttggcgggccgcgcggcggtgccggctag

DBGET integrated database retrieval system