KEGG   Nitrobacter hamburgensis: Nham_0541Help
Entry
Nham_0541         CDS       T00348                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nha  Nitrobacter hamburgensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_0541
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nham_0541
  Amino acid metabolism
   00310 Lysine degradation
    Nham_0541
Enzymes [BR:nha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Nham_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(596468..597709)
Genome map
AA seq 413 aa AA seqDB search
MTEIRVPTLGESVTEATIGKWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLSEIVA
KDGETVAVGALLGQISEGAAPVKATAPAAQPAAAAPASAAAVSPVPAQKSPPPDAPLAPS
VRKLSAESGVDASTVPGSGKDGRVTKGDMLAAIEKAASTATPVNQPAAAVQVRAPSPADD
AAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTGVMTLRTHYKEVFEKKHGVKL
GFMGFFTKACVQALKDIPAANAEIDGTDLIYKNYYHIGIAVGTDKGLVVPVVRDCDRKSI
AEIEKSIADYGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQAGILGMHKIQ
ERPMAIAGKVEIRPMMYLALSYDHRVIDGKDAVTFLVRVKESLEDPARLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatacgcgttccgacgctcggcgaatcggtaaccgaggcgaccatcgggaaa
tggttcaagaaggccggcgacgccgtggcggtcgacgagccgctcgtcgagctcgaaacc
gacaaggtgactatcgaagtgcccgcgccctccgccggcacgctcagtgagatcgtcgcc
aaggacggcgagacggttgccgtcggcgcgctgctcggtcagatttccgagggcgcggca
cccgtgaaggcgaccgcgccggcggcgcagcctgccgccgccgctccagcttccgctgcc
gcggtttcccctgtccccgcgcaaaaatcgccgccccccgacgcgccgcttgcgccctcg
gtgcgaaaactctccgccgagagcggcgtcgacgcctcgaccgtgccgggctccggcaag
gacggccgcgtcaccaagggcgacatgctggccgctatcgagaaggccgcgtccacggcg
accccggtcaaccagccggccgccgccgtgcaggtgcgcgcgccctcgcccgccgacgac
gccgcgcgcgaggagcgcgtgaagatgacgcggctgcgccagaccatcgcgcgccgcctc
aaggaggtgcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgaccggc
gtcatgacgctgcgcacgcactacaaggaggtgttcgagaagaagcacggcgtcaaactc
ggcttcatgggcttcttcaccaaggcctgcgtccaggcgctgaaggacattcccgccgcc
aacgccgaaatcgacggcaccgacctgatctacaagaattactaccacatcggcattgcg
gtaggcaccgacaaggggctcgtcgtgcctgtggtgcgcgactgcgaccgcaagtcgatc
gccgagatcgagaagagcatcgccgactatggccgccgcgcccgcgacggtcagctcaag
atcgatgagatgcagggcggcaccttcaccatcaccaacggcggcatctacggctcgctg
atgtcgacgccgatcctgaacgcgccgcaggccggcattctgggcatgcacaagattcag
gaacggccgatggcgatcgccggcaaggtcgaaatccgcccgatgatgtatctggcgctg
tcctacgaccaccgcgtcatcgacggcaaggacgccgtgaccttcctcgtgcgcgtcaag
gaatcgctcgaagaccccgcgcggctggtgctggatctgtag

DBGET integrated database retrieval system