KEGG   Nitrobacter hamburgensis: Nham_0563Help
Entry
Nham_0563         CDS       T00348                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nha  Nitrobacter hamburgensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nham_0563
Enzymes [BR:nha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nham_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
623362..624108
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPEPDNEATAAVLRARGLEVLLSPVLRFEAVAFEMDPDERYGAVVVTSGNALRA
LAAHPARESLLKLAVFAVGRHTAEAARQAGFQDVVAAGGDAVALRALIIKSVRTKPLAKG
ARILYLAAADRSCDLAGELGARGLAVVTATCYRMTPVASLSREVCDAFAAHRISAVLHYS
RRSARAFLDAVRIGGVEISALAVPQCCISGTVASILRDAGAPHVVVARAPAENAVLEALD
CALRPLSR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttctcgtcacacgacctgaaccggacaatgaagccaccgccgccgtcctgcgg
gcgagggggctcgaggttctgttgtcgccggtgttgcgcttcgaggcggtcgctttcgag
atggacccggatgagcgctatggtgcggtcgtcgtgaccagcggcaacgcgctgcgcgcg
ctcgccgcccatccggccagagagtcgctgttgaagctggccgtgttcgcggtgggccgg
cacaccgcggaggccgcgcgccaggccggatttcaggatgtggtcgcggcaggcggagat
gcggtggccttgcgcgcgctcattataaagagcgtgcgcacgaaacccctggcgaagggg
gccaggattctctatctcgcagcggccgatcgctcatgtgatctcgccggagaactcgga
gcgcgcggtttggctgtcgtgacggcgacgtgttaccggatgacgccggtggcgagcctg
tcgcgcgaggtctgtgatgcgtttgccgcgcaccggatatcggcggtgctgcactattcg
cgccgcagcgcccgggcgttcctggatgccgtccgcatcgggggcgtcgagatatcggct
ttggcggtcccgcaatgttgcatctccggcactgtggcctctattctgcgagacgctggc
gctccccatgtggttgtggcgcgcgcgccggccgaaaatgcggtattggaagcacttgat
tgtgcgttgcggccgctatcgcggtaa

DBGET integrated database retrieval system