KEGG   Nitrobacter hamburgensis: Nham_0864Help
Entry
Nham_0864         CDS       T00348                                 

Definition
(GenBank) Phosphate butyryltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00430  Taurine and hypotaurine metabolism
nha00620  Pyruvate metabolism
nha00640  Propanoate metabolism
nha00680  Methane metabolism
nha01100  Metabolic pathways
nha01120  Microbial metabolism in diverse environments
nha01200  Carbon metabolism
Module
nha_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nham_0864
   00640 Propanoate metabolism
    Nham_0864
  Energy metabolism
   00680 Methane metabolism
    Nham_0864
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Nham_0864
Enzymes [BR:nha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Nham_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: ABE61730
JGI: Nham0864
UniProt: Q1QPW7
Position
958329..959300
Genome map
AA seq 323 aa AA seqDB search
MNAMPANSGQARSPRKYDRLIAAAKAVPPAQTIVVHPCDETSLRGVIDSAAAGIIRPTLV
GPEGKIRDTASKCGLDISGFKIVDVSHSEAAAAKGVELIHAAEGEMLMKGSLHTDELMRS
ITAKVGGLRTNRRISHVFVMDVPAYAETLFVTDAAINIFPDLDAKRDIIQNAIDLYTQTG
FGKSPRVAILSAVETVTQSIPSTIEAAALCKMADRGQITDGVLDGPLAFDNAIDVEAARI
KGIRSEVAGRAQILLVPDLEAGNMLAKNLAYFAKADSAGIVLGARVPVVLTSRADSARAR
MASCAVAALYANARRQQAPTVAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatgccggccaattcaggacaagcgcgctctcccagaaaatatgaccgtctg
atcgcagcggccaaggcggtgccgccggcgcagaccattgtggtgcatccctgcgatgaa
acatcgttgcgcggcgtcatcgatagtgcggcggcgggcatcatccggccgacactggtc
ggacctgaagggaaaatcagggatacggccagcaagtgtggcctggacatttctggcttc
aagatcgtcgatgtttcgcacagcgaggctgcggctgcaaagggcgttgagctcatccat
gctgccgagggcgagatgctgatgaagggcagcttgcacaccgacgaattgatgcgcagc
attacggcaaaggtgggcgggctgcgaaccaatcggcggatcagccatgtgttcgtaatg
gatgtaccggcctatgccgaaacactgtttgtgacggacgcagccatcaacatctttccc
gatctcgatgccaaacgggatatcattcagaacgcgattgatctgtacacgcaaaccgga
ttcgggaaatcgccgcgtgtggcgatcctgtcggcggtcgagaccgttacccagagtatc
ccgtctacgatcgaggccgcggcgctctgcaaaatggccgatcgagggcaaatcaccgac
ggcgtgctcgacggaccgcttgcgttcgacaatgcgatcgatgttgaggcggcacggatc
aagggaatcaggtccgaggttgccgggcgggcgcagatactgctcgttccggatctcgag
gccggaaatatgctggcgaaaaatctcgcctacttcgccaaggcggatagcgctggcatc
gtgctcggcgcccgggtgcctgtcgttctgacgtcgcgtgcagactcggcgcgcgctcgg
atggcgtcctgcgctgtcgcggctctctatgcgaatgcaaggcgccagcaggctccaact
gttgccgcgtga

DBGET integrated database retrieval system