KEGG   Nitrobacter hamburgensis: Nham_0864Help
Entry
Nham_0864         CDS       T00348                                 

Definition
phosphate acetyltransferase (EC:2.3.1.8)
Orthology
K00625  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
nha  Nitrobacter hamburgensis
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_0864
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nham_0864
   00640 Propanoate metabolism
    Nham_0864
  Energy metabolism
   00680 Methane metabolism
    Nham_0864
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Nham_0864
Enzymes [BR:nha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Nham_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
958329..959300
Genome map
AA seq 323 aa AA seqDB search
MNAMPANSGQARSPRKYDRLIAAAKAVPPAQTIVVHPCDETSLRGVIDSAAAGIIRPTLV
GPEGKIRDTASKCGLDISGFKIVDVSHSEAAAAKGVELIHAAEGEMLMKGSLHTDELMRS
ITAKVGGLRTNRRISHVFVMDVPAYAETLFVTDAAINIFPDLDAKRDIIQNAIDLYTQTG
FGKSPRVAILSAVETVTQSIPSTIEAAALCKMADRGQITDGVLDGPLAFDNAIDVEAARI
KGIRSEVAGRAQILLVPDLEAGNMLAKNLAYFAKADSAGIVLGARVPVVLTSRADSARAR
MASCAVAALYANARRQQAPTVAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatgccggccaattcaggacaagcgcgctctcccagaaaatatgaccgtctg
atcgcagcggccaaggcggtgccgccggcgcagaccattgtggtgcatccctgcgatgaa
acatcgttgcgcggcgtcatcgatagtgcggcggcgggcatcatccggccgacactggtc
ggacctgaagggaaaatcagggatacggccagcaagtgtggcctggacatttctggcttc
aagatcgtcgatgtttcgcacagcgaggctgcggctgcaaagggcgttgagctcatccat
gctgccgagggcgagatgctgatgaagggcagcttgcacaccgacgaattgatgcgcagc
attacggcaaaggtgggcgggctgcgaaccaatcggcggatcagccatgtgttcgtaatg
gatgtaccggcctatgccgaaacactgtttgtgacggacgcagccatcaacatctttccc
gatctcgatgccaaacgggatatcattcagaacgcgattgatctgtacacgcaaaccgga
ttcgggaaatcgccgcgtgtggcgatcctgtcggcggtcgagaccgttacccagagtatc
ccgtctacgatcgaggccgcggcgctctgcaaaatggccgatcgagggcaaatcaccgac
ggcgtgctcgacggaccgcttgcgttcgacaatgcgatcgatgttgaggcggcacggatc
aagggaatcaggtccgaggttgccgggcgggcgcagatactgctcgttccggatctcgag
gccggaaatatgctggcgaaaaatctcgcctacttcgccaaggcggatagcgctggcatc
gtgctcggcgcccgggtgcctgtcgttctgacgtcgcgtgcagactcggcgcgcgctcgg
atggcgtcctgcgctgtcgcggctctctatgcgaatgcaaggcgccagcaggctccaact
gttgccgcgtga

DBGET integrated database retrieval system