KEGG   Nitrobacter hamburgensis: Nham_0864Help
Entry
Nham_0864         CDS       T00348                                 

Definition
phosphate acetyltransferase (EC:2.3.1.8)
Orthology
K00625  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
nha  Nitrobacter hamburgensis
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Class
Metabolism; Overview; Carbon metabolism [PATH:nha01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nha00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nha00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:nha00680]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:nha00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
958329..959300
Genome map
AA seq 323 aa AA seqDB search
MNAMPANSGQARSPRKYDRLIAAAKAVPPAQTIVVHPCDETSLRGVIDSAAAGIIRPTLV
GPEGKIRDTASKCGLDISGFKIVDVSHSEAAAAKGVELIHAAEGEMLMKGSLHTDELMRS
ITAKVGGLRTNRRISHVFVMDVPAYAETLFVTDAAINIFPDLDAKRDIIQNAIDLYTQTG
FGKSPRVAILSAVETVTQSIPSTIEAAALCKMADRGQITDGVLDGPLAFDNAIDVEAARI
KGIRSEVAGRAQILLVPDLEAGNMLAKNLAYFAKADSAGIVLGARVPVVLTSRADSARAR
MASCAVAALYANARRQQAPTVAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatgccggccaattcaggacaagcgcgctctcccagaaaatatgaccgtctg
atcgcagcggccaaggcggtgccgccggcgcagaccattgtggtgcatccctgcgatgaa
acatcgttgcgcggcgtcatcgatagtgcggcggcgggcatcatccggccgacactggtc
ggacctgaagggaaaatcagggatacggccagcaagtgtggcctggacatttctggcttc
aagatcgtcgatgtttcgcacagcgaggctgcggctgcaaagggcgttgagctcatccat
gctgccgagggcgagatgctgatgaagggcagcttgcacaccgacgaattgatgcgcagc
attacggcaaaggtgggcgggctgcgaaccaatcggcggatcagccatgtgttcgtaatg
gatgtaccggcctatgccgaaacactgtttgtgacggacgcagccatcaacatctttccc
gatctcgatgccaaacgggatatcattcagaacgcgattgatctgtacacgcaaaccgga
ttcgggaaatcgccgcgtgtggcgatcctgtcggcggtcgagaccgttacccagagtatc
ccgtctacgatcgaggccgcggcgctctgcaaaatggccgatcgagggcaaatcaccgac
ggcgtgctcgacggaccgcttgcgttcgacaatgcgatcgatgttgaggcggcacggatc
aagggaatcaggtccgaggttgccgggcgggcgcagatactgctcgttccggatctcgag
gccggaaatatgctggcgaaaaatctcgcctacttcgccaaggcggatagcgctggcatc
gtgctcggcgcccgggtgcctgtcgttctgacgtcgcgtgcagactcggcgcgcgctcgg
atggcgtcctgcgctgtcgcggctctctatgcgaatgcaaggcgccagcaggctccaact
gttgccgcgtga

DBGET integrated database retrieval system