KEGG   Nitrobacter hamburgensis: Nham_0911Help
Entry
Nham_0911         CDS       T00348                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00010  Glycolysis / Gluconeogenesis
nha00030  Pentose phosphate pathway
nha00051  Fructose and mannose metabolism
nha00052  Galactose metabolism
nha00680  Methane metabolism
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_0911
   00030 Pentose phosphate pathway
    Nham_0911
   00051 Fructose and mannose metabolism
    Nham_0911
   00052 Galactose metabolism
    Nham_0911
  Energy metabolism
   00680 Methane metabolism
    Nham_0911
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nham_0911
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Nham_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABE61769
JGI: Nham0911
UniProt: Q1QPS8
Position
complement(1006436..1007659)
Genome map
AA seq 407 aa AA seqDB search
MHSETCQCWEVGVARKRIGILTGGGDVPGLNAIIKTVTYRGSEDDIEVVGLRRGWEALTH
LNLEDPTSRSHYLIPLNRENTRTVDRRGGTMLHSSRTNPSKMKKLPDHLVGTDLPVTTNT
NGGTETRTWDLTGQVLANLSGLGIEHLIAIGGDDTLSYAARLDELGVKIIAIPKTMDNDV
RNTEYCIGFSTAITRASDAIQRQRTTIGSHERIGIFRVFGRDAGFTALYTAYATSIRCVI
PEYKVNLDKLIRLLLEEKRANPSNYALIVLSEGAEWEGYEAHEYGEPDPYGHRKKASVAE
VLADEIKAHTGEETIVSDLTYDLRSGDPDFIDKLVALTFGNMAYDAVLEGRTGLMSALVE
GCYDLVPIPDANLGPRKLDVASTYNMERYRPIYADKRGLPIFLNRAS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgcatagcgagacatgccaatgctgggaggtgggcgtggcgagaaagcgcattggcatt
ctaacgggcggcggcgacgtccccggtctcaatgcaatcattaagaccgtgacttatcgc
ggcagtgaggacgacatcgaggtcgtgggtcttcgccgtggttgggaggccctgacgcat
ctgaatctcgaggacccgaccagcaggtctcactacctcatcccgctgaaccgtgaaaac
acgcgcaccgtcgaccggcgcggcggcaccatgctgcattcgagccgcaccaatccgtcc
aaaatgaaaaagttacccgaccatctcgtcggcactgaccttccagttaccacgaatacc
aacggcggcaccgaaaccaggacctgggacctgaccggccaggtgctcgcgaacttgtca
ggactaggcatcgaacacctaatcgccattggcggagacgacacgctcagttatgcggcc
aggctcgacgaactcggcgtcaagatcatcgccattccgaagacgatggacaacgacgtt
cgcaacaccgagtactgcattggcttctcgaccgcgatcacccgcgccagcgatgccatc
cagcggcagcgcaccactatcggctcccacgagcgcattggtattttccgggtctttggc
cgcgatgccggatttacggcactctataccgcgtacgcgacctcgatccggtgcgtcata
ccggagtacaaggtcaatctcgacaaactgatccggttgctgctcgaggagaagcgcgcc
aacccaagcaactacgcgctgatcgtgctcagcgagggcgccgagtgggagggctacgaa
gcgcatgaatacggcgagcctgacccctacggtcaccgcaagaaggcgagcgtcgccgaa
gtgcttgctgacgaaatcaaagcgcacaccggcgaggagactatcgtctctgacctaacc
tatgacctgcgatcgggcgatccggacttcatcgacaagctcgtcgccctgactttcggt
aacatggcctacgatgcggtcctggaaggcaggaccggcctgatgtcggcgctggtcgag
ggctgttacgacctggtgcccatccctgacgccaacctcgggccacgcaaattggacgtc
gccagcacgtacaacatggaacgctaccgccccatctacgccgataagcgggggctgccg
atctttctcaaccgcgcgtcatag

DBGET integrated database retrieval system