KEGG   Nitrobacter hamburgensis: Nham_0911Help
Entry
Nham_0911         CDS       T00348                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_0911
   01230 Biosynthesis of amino acids
    Nham_0911
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_0911
   00030 Pentose phosphate pathway
    Nham_0911
   00051 Fructose and mannose metabolism
    Nham_0911
   00052 Galactose metabolism
    Nham_0911
  Energy metabolism
   00680 Methane metabolism
    Nham_0911
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Nham_0911
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nham_0911
Protein phosphatases and associated proteins [BR:nha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Nham_0911
Messenger RNA biogenesis [BR:nha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Nham_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1006436..1007659)
Genome map
AA seq 407 aa AA seqDB search
MHSETCQCWEVGVARKRIGILTGGGDVPGLNAIIKTVTYRGSEDDIEVVGLRRGWEALTH
LNLEDPTSRSHYLIPLNRENTRTVDRRGGTMLHSSRTNPSKMKKLPDHLVGTDLPVTTNT
NGGTETRTWDLTGQVLANLSGLGIEHLIAIGGDDTLSYAARLDELGVKIIAIPKTMDNDV
RNTEYCIGFSTAITRASDAIQRQRTTIGSHERIGIFRVFGRDAGFTALYTAYATSIRCVI
PEYKVNLDKLIRLLLEEKRANPSNYALIVLSEGAEWEGYEAHEYGEPDPYGHRKKASVAE
VLADEIKAHTGEETIVSDLTYDLRSGDPDFIDKLVALTFGNMAYDAVLEGRTGLMSALVE
GCYDLVPIPDANLGPRKLDVASTYNMERYRPIYADKRGLPIFLNRAS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgcatagcgagacatgccaatgctgggaggtgggcgtggcgagaaagcgcattggcatt
ctaacgggcggcggcgacgtccccggtctcaatgcaatcattaagaccgtgacttatcgc
ggcagtgaggacgacatcgaggtcgtgggtcttcgccgtggttgggaggccctgacgcat
ctgaatctcgaggacccgaccagcaggtctcactacctcatcccgctgaaccgtgaaaac
acgcgcaccgtcgaccggcgcggcggcaccatgctgcattcgagccgcaccaatccgtcc
aaaatgaaaaagttacccgaccatctcgtcggcactgaccttccagttaccacgaatacc
aacggcggcaccgaaaccaggacctgggacctgaccggccaggtgctcgcgaacttgtca
ggactaggcatcgaacacctaatcgccattggcggagacgacacgctcagttatgcggcc
aggctcgacgaactcggcgtcaagatcatcgccattccgaagacgatggacaacgacgtt
cgcaacaccgagtactgcattggcttctcgaccgcgatcacccgcgccagcgatgccatc
cagcggcagcgcaccactatcggctcccacgagcgcattggtattttccgggtctttggc
cgcgatgccggatttacggcactctataccgcgtacgcgacctcgatccggtgcgtcata
ccggagtacaaggtcaatctcgacaaactgatccggttgctgctcgaggagaagcgcgcc
aacccaagcaactacgcgctgatcgtgctcagcgagggcgccgagtgggagggctacgaa
gcgcatgaatacggcgagcctgacccctacggtcaccgcaagaaggcgagcgtcgccgaa
gtgcttgctgacgaaatcaaagcgcacaccggcgaggagactatcgtctctgacctaacc
tatgacctgcgatcgggcgatccggacttcatcgacaagctcgtcgccctgactttcggt
aacatggcctacgatgcggtcctggaaggcaggaccggcctgatgtcggcgctggtcgag
ggctgttacgacctggtgcccatccctgacgccaacctcgggccacgcaaattggacgtc
gccagcacgtacaacatggaacgctaccgccccatctacgccgataagcgggggctgccg
atctttctcaaccgcgcgtcatag

DBGET integrated database retrieval system