KEGG   Nitrobacter hamburgensis: Nham_0995Help
Entry
Nham_0995         CDS       T00348                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
nha  Nitrobacter hamburgensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nha00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1102382..1104784)
Genome map
AA seq 800 aa AA seqDB search
MPLDKPAPGWPGSPARWTSSTKSGVGTALEPGSSVWFTVSHGIVNEVYYPRIDQACIRDL
GLIVADGHGFFSEQKRDTRSTIRLVAEGVPAFVISSTCTQGRYQIEKLVFADPRRDVVLQ
RIALQALVGSTAEYRLYALLAPHLVNKGAGNTAWVDDYKGVPMLFAEGGGTALALGCSPP
FVARSVGFVGVSDGWQDLRQHCELRWHYDVARNGNVALIGEIGLAAGSGSVVLALGFGRT
AAEAALRVRMSLDDDTETKIEEYIAGWRTWQDTLLPLDPAGHSTNHNSYRVSTAVLRAHE
ARSFAGGYIASLSVPWGFAKGDGDLGGYHLVWPRDLVENAGGLLAAGAKKEARQVIAYLQ
GVQEADGHWPQNCWLDGTPYWNGVQLDECAFPILLVDLAFREGALSGAELPGIWPMIEKA
AAFIVGNGPVTGQDRWEEDSGYSPFTLAVVIAALLAAADIADRLSAPGKAAYLRETADVW
NSSIERWTYATGTSLAETIGVDGYYARIAPPEVADAASPLNGFVPIKNRPPQSSCQPASL
VVSPDALALVRFGLRAADDPRILNTVRVIDALLKVDLPAGPCWHRYNGDGYGEHEDGRPF
DGTGTGRCWPLLTGERAHYELAAGHRATAETLLAALEGFASDGHLIPEQIWEAADIPERE
LFLGRPSGSAMPLVWAHAEHVKLLRSLRDGRVFDMPPQPRQRYQVQGQRPRHAIWRFNNK
CRRIPAGRVLRIELSSEAVVHWSADDWRNVRDTATADSGLGIHFADLDTEALKPGGTIVF
TIHWSAQDRWEGVDYRLDVA
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcccttagacaaacccgcgccggggtggcccggcagcccggcgcggtggacgtcgagt
accaaaagtggcgtcggcacggcgctggagcccggcagtagcgtctggttcaccgtgagc
cacggtatcgtcaacgaggtctactatcctcggatcgaccaggcatgcattcgagattta
ggcctcatcgtcgctgacgggcacgggtttttctcggaacaaaagcgcgacacacgtagt
accattcgattggtcgctgaaggtgtgcccgcttttgtcattagcagcacctgtactcag
ggccgttatcaaatcgagaaattggtgtttgccgatcctcgccgcgacgtcgtgcttcag
cgtatcgcattgcaggcgctcgtgggctcgacggcggaataccggctctatgcactgctc
gcgccgcacctggtcaacaagggagcgggcaataccgcctgggtcgacgactacaagggc
gtgccgatgctctttgccgaaggcggcggaacggcgcttgctctcggttgctcgccgcct
ttcgttgcgagatcggtcggcttcgtcggcgtctcggacggctggcaggatctgcggcag
cattgcgaactgcgctggcattacgatgtcgcgcggaacggcaatgttgccctgatcggc
gaaatcggcctggcggcaggtagcggcagcgttgtgctggccttgggttttggcagaacg
gccgcagaggcagcgctccgcgttcgcatgagtctcgacgacgacaccgagacgaagatc
gaagaatacatcgccggatggcgcacctggcaggatacgcttctgccgctcgaccccgcc
ggccattcaaccaaccacaatagctacagagtgagcaccgccgtactgcgcgcgcatgaa
gcccgctcctttgccggcggctatatcgcgagcctgtccgtgccttggggcttcgccaag
ggggacggcgatctcggcggttatcatctggtctggccgcgcgatctcgtcgagaacgcg
ggcggactgcttgccgcgggcgcgaagaaagaagcacggcaggtcatcgcctatcttcaa
ggagttcaagaggcggacggtcattggccccagaattgctggctcgacggcacgccctat
tggaatggggtgcaacttgacgaatgcgcctttcccatcttgctcgttgaccttgccttt
cgtgagggcgcgttatccggggcggagttgccgggcatctggccgatgatcgagaaagca
gccgcgttcatcgtcggcaacgggcctgttacggggcaggatcggtgggaggaagacagc
ggttattcaccctttacgctcgcggttgtgatcgcggcgcttttggccgctgccgatatt
gccgaccgcctgtccgcgcccgggaaagcggcctatctccgcgaaaccgccgacgtctgg
aacagctcgatcgagcggtggacctatgccaccggcacatcgctcgccgaaacgataggc
gttgacggctattacgctcgcatcgctccgcctgaggtcgccgatgccgcttcgcccctg
aacggattcgttccgatcaagaaccgcccgccccagtcgagctgccagccggcctcgctg
gtggtgagtcccgatgcactggcgctggtgcgcttcgggctgcgcgccgccgacgacccg
cgcattctgaacaccgtgcgcgtaatcgatgccctgctgaaagtcgatttgcctgcgggt
ccgtgctggcatcgctacaatggcgacggctacggtgaacacgaggacggccgaccgttc
gacggcaccggaacggggcgatgctggccccttctgaccggcgaacgcgcgcattacgaa
ctcgcagccggccaccgggccacggccgagaccttgctggcggcgctcgaaggctttgca
agcgacggccatctgatccccgagcagatttgggaagccgcagacattcccgagcgggag
ctttttttgggccgtccttccgggtcggcgatgccgctggtctgggcgcatgcggagcat
gtcaagctcctgcgctcgctcagggacggccgcgtcttcgatatgccgccgcagccccgg
cagcgctatcaggttcaaggccagcgcccgcgccacgccatctggcgcttcaacaacaaa
tgccgccgcataccggcggggcgcgttttacgaatcgagctgtcgtcggaggccgttgtc
cattggagcgcggacgattggcgtaacgtccgtgacacagcgaccgcggacagcggcctc
ggcattcacttcgccgacctcgataccgaagctctcaagcccggcggcaccatcgtcttc
accatccactggtcggcgcaagatcgctgggagggtgtcgactacagacttgacgtcgcc
tga

DBGET integrated database retrieval system