KEGG   Nitrobacter hamburgensis: Nham_1018Help
Entry
Nham_1018         CDS       T00348                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nham_1018
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Nham_1018
Enzymes [BR:nha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Nham_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1136718..1138718
Genome map
AA seq 666 aa AA seqDB search
MATNEAQQPGLPAPFTWSDVEAIFAAAGGTKGPGSLTGLTLPEFLALQLHGMPLVAPLTT
TCCGKSDTKGRGARSALIRGLRGLPPFDGKQFPRLPWGGSPVADEDIDRIEMWIEEGCPE
GLIGSVALAGEVSVTTEARVQVKGLAGPVFGPASDPAAWRYAKGELRQRMDVDVLGEPQK
ERLRYAFRELYKLNKWVGDKRSYNNLALIHQNHCQHGWERFLPWHRVYLYEFEQALQDFC
PDVTMPWWDFPAPRYKPENPADGAILPDAFKGFLTDASVRFLRAHGFPAEVETLVGQLWA
NPTQVYDAVSAACGADYVEGENRKRLIDALLEANSLWYPLRYSGQFGKGTINTAIHYHYP
AQEDIDEILSLRTFRDFGGGSLYVDSFGFLDQNPHNTMHIWTGGMNPAFTTDAPANRNSA
VRVAGRKFHQRDDLYSEPQFGDMFSNLTASYDPIFWPVHANIDRLWWRWQQDHPDGLPAD
LDSAVTPWSYAVRDTLDMNRFGYEYVRGGCLMPVGLTNPVGRFVSAPIAVPDATKTFRSA
EVRLHRVPQLPRSCFIRVFLNTPDADASTPLDVPGYAGYASVFGHGECFGGPGHCEIPPA
ENRKFDLRERSMNTPRNHRIDVTRAARRLIVAGATRLTVSLVVIGASYEEDRELLRLDGV
SLNFLD
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
gtggccacaaatgaagcgcagcagccaggtttgcccgcgccatttacatggagcgatgtc
gaagcgatctttgccgccgcaggtggtaccaagggacccggcagcctgacggggctgacg
ctgcctgaattcctggcgctccagctgcatgggatgccgctggtcgcgccactcaccacc
acgtgctgcggcaaaagcgataccaagggccgtggtgcgcgatcggcgctgatccgcggg
ctgcgcggactgccgccgttcgacgggaagcagtttcctcgactgccctggggcggctcg
ccggtcgccgatgaggatatcgaccggatcgaaatgtggatcgaggaaggctgtcccgag
ggcttgatcgggtcggttgcgctcgccggcgaagtgagcgtgacgaccgaggctcgcgtc
caggtcaaggggcttgccggtcccgtctttggtccggcatccgatccggcggcgtggcgc
tacgccaaaggcgagttgcggcagcgaatggatgtcgatgtgctgggcgagccgcagaaa
gagcggctgcgctacgcctttcgcgaactctacaagctcaacaaatgggtcggtgacaag
cgcagctacaacaatctggccttgatccaccagaaccactgtcagcatggctgggagcgt
ttcctgccgtggcatcgcgtctatctttatgagttcgagcaagccctgcaggacttttgc
ccggatgtgaccatgccatggtgggattttccggccccgcgctacaagccggagaatccg
gccgatggcgcgatccttcccgatgcattcaagggtttcctcaccgatgcctcggttcgc
ttcctgcgcgctcatggtttcccggccgaggtcgagacgctggtgggccaactgtgggcc
aatccgacgcaagtctacgatgcagtcagcgccgcttgcggcgcggactatgtggaggga
gagaaccgcaaaaggctgatcgacgcgctgctggaagccaattcgctctggtatccgctg
cgctattccggccaattcggcaaaggcacgatcaacacggccatccactaccactatccg
gctcaggaagacatcgacgagattctcagcctgcgcaccttccgcgatttcggcggcggc
agcctctatgtcgacagcttcggattcctggaccagaacccgcacaacacgatgcatatc
tggaccgggggcatgaacccggcgttcacgaccgatgctcccgccaaccgcaacagcgcg
gtgcgcgttgccggccgcaagttccaccagcgcgacgatctctattcggagccccagttc
ggcgacatgttctcgaacctgaccgcgtcctacgacccgatcttctggcccgtgcacgcg
aatatagaccggctctggtggcgctggcagcaggatcacccggacggcctgccggccgat
ctcgattccgctgtgacgccgtggagctacgccgtgcgcgatacgctcgacatgaaccgc
ttcggctatgagtatgttcgcggcggatgcctcatgccggtgggattgaccaatcccgtt
ggacgcttcgtctcggcgccgattgccgtacccgatgcaacgaagaccttccgctcggcc
gaagtgcggctgcaccgcgtgccgcaactgccgcgctcatgcttcatccgcgtgtttctc
aacacgccggatgccgacgccagcacgccgctcgatgtgccgggctacgccggctacgct
tcggtcttcggccatggtgagtgtttcggcgggcctgggcattgcgaaattccgccagcg
gagaatcgcaagttcgatctgcgcgagcgcagcatgaacacgccgcgcaaccaccgcatc
gatgtgactcgcgcggcacggcggctgatcgtggccggtgccacccgcctcacggtgagc
ctggtggtgatcggcgcctcctatgaggaagaccgcgagttgctgaggctggacggggtc
tcgctcaactttctcgattga

DBGET integrated database retrieval system