KEGG   Nitrobacter hamburgensis: Nham_1097Help
Entry
Nham_1097         CDS       T00348                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00630  Glyoxylate and dicarboxylate metabolism
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01200  Carbon metabolism
Module
nha_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nham_1097
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Nham_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABE61945
JGI: Nham1097
UniProt: Q1QPA2
Position
1240012..1241319
Genome map
AA seq 435 aa AA seqDB search
MSKTFEQLVPAPKGRFEGISRPYSPADVERLRGSVEIKYTLAEKGANRLWESLKTEPYVN
SLGAVTGNQAMQQARAGLPAIYLSGWQVAADANTAGTMYPDQSLYPANAGPELCRRINRT
FQRADQIEHSEGGAKIDWFVPIVADAEAGFGGPLNSFEIMKAYIEAGAAGVHFEDQLASE
KKCGHMGGKVLIPTAAHERNLIAARLAADVCGTPTFVLARTDAESAKLITSDVDERDHEF
ITGERTAEGFYRLKPGTGLDHCIKRGLAFAKYADLLWWETSKPDLDGARKFAEAVKKVYP
NKMLAYNCSPSFNWEANIDKDTIAKFQKEIGAMGYKFQFVTLAGFHSLNHGMFELARGYK
AEGMAAYSRLQQAEFASEKFGYSATRHQREVGTGYFDLVSTTITGGQSSTTALHDSTETA
QFKSQGSQIRVQAAE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagacctttgagcagctcgttcccgccccgaagggccgttttgaggggatcagc
cgtccctacagcccggcggacgtcgaaaggctgcgcggctccgtggagatcaagtacacg
ctggccgagaagggcgcgaaccggctctgggaatcgctgaagacggagccctatgtgaat
tcgctcggcgccgtcaccggcaaccaggcgatgcagcaggcgcgcgccggtctgcccgcg
atctatctctccggctggcaggtcgccgccgacgccaacaccgcgggcacgatgtatccg
gaccagagcctttacccggccaacgccggtcctgaactgtgccgccgcatcaaccgcacc
ttccagcgcgccgaccagatcgagcattccgaaggcggcgccaagatcgactggttcgtg
ccgatcgtggccgacgccgaagcgggattcggcggtccgctcaactcgttcgagatcatg
aaggcctatatcgaggcgggcgcggccggcgtccacttcgaggatcaactcgcgtcggaa
aagaagtgcggccatatgggcggcaaggtgctgatcccgaccgcggcgcatgagcgtaac
ctgatcgcggcgcggctcgccgccgatgtctgcggcacaccaacgttcgtgctggcgcgc
accgatgcggagagcgccaagctcatcacctcggacgtcgacgagcgcgatcacgagttc
atcaccggcgagcgcacggcggaaggcttctatcgcctcaagcccggcaccggcctcgat
cactgcatcaagcgcggtttggccttcgccaagtatgccgatctgttgtggtgggagacc
tcgaagccggatctcgatggcgcacgcaagttcgccgaagccgtgaagaaggtctatccg
aacaagatgctggcctacaattgctcgccgtctttcaattgggaggccaacatcgacaag
gacaccatcgccaagttccaaaaggagatcggcgcgatgggctacaagttccagttcgtg
acgctggcgggctttcactcgctcaatcacggcatgttcgaactggcgcggggctacaag
gccgaaggcatggcggcgtattcccgcctgcagcaggccgagtttgcctcggagaagttc
ggctactcggcgacgcgccatcagcgcgaggtcggcaccggctacttcgatctggtctcg
accacgatcaccggcggccagtcgtcgaccaccgcgcttcacgactcgactgagaccgcg
cagttcaagtcgcaaggatcacagatcagggttcaggcggctgaataa

DBGET integrated database retrieval system