KEGG   Nitrobacter hamburgensis: Nham_1131Help
Entry
Nham_1131         CDS       T00348                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nha  Nitrobacter hamburgensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nham_1131
   00052 Galactose metabolism
    Nham_1131
   00500 Starch and sucrose metabolism
    Nham_1131
   00520 Amino sugar and nucleotide sugar metabolism
    Nham_1131
Enzymes [BR:nha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nham_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1276491..1277366)
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVVDEAREAGIEHFVFVTGRNK
STIEDHFDRQFELDETLKARGKKAEMDVLAQFQPEAGAMSFTRQQAPLGLGHAVWCARDI
VGEEPFAVVLPDELVLNTPGCLKQMMRAAEELGPKSNIVAVEAVPDDMTHNYGICGVGKR
NGNIFEIDGMVEKPPKGTAPSNLSITGRYILQPEIFKILETQERGAGGEIQLTDAMIILS
KSQAFHGLEFAGERHDCGSRAGFLRANIAFGMARADLRDGLRAEMQKYLKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgttttccccgtcgccggcctcggcacccgcgtccttcccgcc
accaaggctatgccgaaggaaatgctcacgatcgtcgatcggccgctgatccagtacgtg
gtcgacgaagccagggaagccggcatcgagcatttcgttttcgtcaccggccgcaacaag
agcacgatcgaggatcactttgatcgccagttcgaactggacgaaacgctgaaggcgcgc
ggcaagaaggccgagatggacgtgctggcgcaattccagcctgaggcgggcgccatgagt
tttacccggcaacaggcgccgctcgggctcggccacgcggtgtggtgcgcccgcgatatc
gtcggcgaggagcctttcgcggtggtgctccccgacgaactggtgctgaacacaccaggc
tgcctcaagcagatgatgcgggcggcggaggaactcgggccgaaatccaacatcgtcgcc
gtcgaagccgtgcccgacgatatgacccacaattacggcatctgcggcgtcggcaagcgc
aacggcaatatcttcgagatcgacggcatggtggagaagccgcccaagggcacggcaccc
tccaatctctccatcaccgggcgctacatcctgcagcccgaaatattcaagattctggaa
acccaggaacgtggcgccggcggcgagatccagctcaccgacgccatgatcatcctgtcg
aaatcgcaagccttccacggtctcgaattcgcgggcgagcgtcacgactgcggctcgcgc
gcgggtttcctgcgcgccaacatcgcattcgggatggcgcgcgccgatctgcgcgacggc
ttgcgcgcggaaatgcaaaaatatctcaaggcgtaa

DBGET integrated database retrieval system