KEGG   Nitrobacter hamburgensis: Nham_1274Help
Entry
Nham_1274         CDS       T00348                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nha  Nitrobacter hamburgensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nha00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nha00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1431950..1433407
Genome map
AA seq 485 aa AA seqDB search
MKLRELFGDDAAMDARTGELAVTGLAVDSREVKPGDLFFALAGTKTDGARFIDAAIAAGA
VAVVGDHAPAGACVPSVATSNPRRALALAAAKFYPRQPATIAAVTGTSGKTSVAAFTRQI
WQRLGHPSASIGTIGVVAPSRAVYGSVTTPDPISLHRELDQLVGEGVTHLALEASSHGLD
QYRLDGVRVRAAGFTNLSRDHMDYHPTVAHYLDTKLRLFRDLVEPDGVAVISADHDCSGT
VIEAASARNVRIMRVGRRGDGTHSGIRLADAVIEGFAQRVTLEHAGRERIIRLPLVGEFQ
IENALVSAGLVIGTGGDADQVFAALEHLEGAKGRLELVGERNGAPVFVDYAHKPDALAKA
LQALRPYASRKLVVVFGAGGDRDAGKRPLMGEVAAANADVVIVTDDNPRSENPAAIRAAI
LAAATGAREIGDRAEAIRTAIVGLQPGDALLIAGKGHETGQIVGDRVLPFSDHDAAIAAL
TSRAT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcgcgagcttttcggcgacgatgccgccatggacgcgcggacaggcgagctt
gccgtcaccggcctcgccgtggacagccgcgaggtgaagccgggcgatcttttcttcgcg
cttgccggcacaaagaccgacggcgcgcggttcatcgatgccgcgatcgcggccggcgcg
gttgcggtcgtcggtgaccacgcgccggcgggtgcctgtgttccgtccgtcgccacatcg
aatccgcgccgggcgctggcgctggcggcggcgaaattctatccgcggcagcccgcgacc
atcgccgctgtcaccggcaccagcggcaagacttcggtcgcagccttcacacggcagatc
tggcagcggctcgggcacccgtccgccagcatcggcaccatcggcgtggttgcgccgtcg
cgtgcggtgtacggctcggtgacgacgcccgatccgatctcattgcatcgcgaactcgat
cagcttgtgggcgagggcgtcacgcatctggcgctggaagcgtcttcgcacggactcgat
caatatcgactcgacggcgtgcgtgtgcgcgccgccggcttcaccaacctgtcgcgcgac
cacatggattatcacccgaccgtcgcgcactatctcgatacaaaactgcggctgttccgc
gatctggtcgagccggacggcgtcgcggtgatttccgccgatcacgactgttcgggcacg
gtgatcgaggcggcgagcgcgcgtaacgtccggataatgcgtgtcggccgccgcggcgac
ggcacgcatagcggcattcgtctggccgatgcggtcatcgagggctttgcgcaacgggtg
actctcgaacacgccggacgcgagcgtatcattcgtctgcccctggtcggcgaattccag
atcgagaacgcgctggtgtcggcggggctcgtcatcggcaccggcggcgacgcggatcag
gtgttcgcggcactcgagcatctcgaaggcgcgaaaggacggcttgagctggtcggcgag
cgcaacggcgcgccggtttttgtcgattacgcccacaagccggacgcgctagcgaaggcg
ttgcaggcgttgcgaccttacgctagccgcaaactcgtagtggtgttcggtgccggcggc
gatcgcgacgcggggaaacgtccgctgatgggcgaggtcgccgccgccaacgcggacgtg
gtcatcgtcaccgacgacaacccgcgcagcgaaaatcccgccgccattcgtgcagcgatc
ctcgccgccgccacaggcgcgcgcgagatcggcgatcgcgccgaggcgatccgaactgcg
attgtcggcttgcaaccgggcgacgcattgctgatcgccggcaagggccacgagaccggg
cagatcgtcggcgatcgcgtgctgccgttcagcgatcatgacgccgccatcgcagcgctg
acttcgagggcgacatga

DBGET integrated database retrieval system