KEGG   Nitrobacter hamburgensis: Nham_1443Help
Entry
Nham_1443         CDS       T00348                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
nha  Nitrobacter hamburgensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nha00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:nha02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1627598..1628047)
Genome map
AA seq 149 aa AA seqDB search
MRLIPAVLLACTTLASPMAMAQNTAPTAADAQSFNKALASASVERGARIAKQCEICHNVV
EGKGPKVGPDLYGVVNRPIASMPGFNYSAALKAKGGKWTFAELDKWLTDPRADVKGTHMT
FAGLKSESKRAAVIAYLNTLSKSPVPLPQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgatcccggcagtacttctggcctgcaccaccctcgcgtcgcccatggcgatg
gcccaaaacactgcacccaccgctgctgacgcgcagtcgttcaataaggcgcttgcgagc
gcctcggtcgaacgcggtgcgcggatcgccaagcagtgcgagatttgccacaacgttgtg
gaaggcaaaggtcccaaggtcggccccgatctctacggcgtcgtcaatcggccgatcgct
tcgatgccgggctttaactacagcgccgccttgaaggccaagggcggcaaatggaccttc
gccgagctcgacaaatggctgaccgatccgcgcgccgacgttaagggtacgcacatgacc
ttcgccggcctgaagagcgagagcaagcgcgctgccgtgattgcctatctcaatacgctc
tcgaagagcccggtgccgctgccgcaatag

DBGET integrated database retrieval system