KEGG   Nitrobacter hamburgensis: Nham_1443Help
Entry
Nham_1443         CDS       T00348                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
nha  Nitrobacter hamburgensis
Pathway
nha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nham_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ABE62265
JGI: Nham1443
UniProt: Q1QND2
Position
complement(1627598..1628047)
Genome map
AA seq 149 aa AA seqDB search
MRLIPAVLLACTTLASPMAMAQNTAPTAADAQSFNKALASASVERGARIAKQCEICHNVV
EGKGPKVGPDLYGVVNRPIASMPGFNYSAALKAKGGKWTFAELDKWLTDPRADVKGTHMT
FAGLKSESKRAAVIAYLNTLSKSPVPLPQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgatcccggcagtacttctggcctgcaccaccctcgcgtcgcccatggcgatg
gcccaaaacactgcacccaccgctgctgacgcgcagtcgttcaataaggcgcttgcgagc
gcctcggtcgaacgcggtgcgcggatcgccaagcagtgcgagatttgccacaacgttgtg
gaaggcaaaggtcccaaggtcggccccgatctctacggcgtcgtcaatcggccgatcgct
tcgatgccgggctttaactacagcgccgccttgaaggccaagggcggcaaatggaccttc
gccgagctcgacaaatggctgaccgatccgcgcgccgacgttaagggtacgcacatgacc
ttcgccggcctgaagagcgagagcaagcgcgctgccgtgattgcctatctcaatacgctc
tcgaagagcccggtgccgctgccgcaatag

DBGET integrated database retrieval system