KEGG   Nitrobacter hamburgensis: Nham_1467Help
Entry
Nham_1467         CDS       T00348                                 

Definition
(RefSeq) 4-alpha-glucanotransferase (EC:2.4.1.25)
  KO
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nha  Nitrobacter hamburgensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nham_1467
Enzymes [BR:nha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Nham_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1665784..1667724
Genome map
AA seq 646 aa AA seqDB search
MDVYSKARDLGIDLEFVDGQGLRHVVNGERLRAILDGLPSPSRHPYLKQPVVIVADGGDC
RVPVDAEANGIGWRLVERNAVLARGRVAGEAIDLPRSAAIGTYRLELVSDNGDTIDSIPL
LVTPAAAYQGSFDRVWVLSVQLYGVSSSGNWGIGDFTDLAALIELTADWGCAGIGLNPLH
ALFDDRPLECSPYAPNSRLFLNPLYIDPERLPDFPGAWLAQHREQLGQARHGELIDYAAV
AELKFAALRHAFSIFRRGRSQSEFEIFRQERGELLQRFACFEVLRRQFGPLPWWQWPEEW
RRPDDARIQAFRNGLLRAEVEFVEFVQWCAAAQLQSCADLAAERGMAVGLYLDVAVGVQA
GGFDAWNEQGAISRGLSVGAPPDQLNTTGQDWGLAGFNTAGLEASGFAPFREMLRASMRF
AGAIRLDHVLGLNRLYLIPSGASPRDGVYVEMPLEALLGVIAQESVGQRCITIGEDLGTV
PDGFRDILAAWGVWSYKVMMFERGHDGAFIGPSGYAANALVTFNTHDLASFAGWQSHSDL
RVKRELGLDPGETDAMRADALRAFEWKLREDHIASKNFFGAVEFLAHTPSRILAVALDDL
IGLKDQPNIPGTVNEHPNWRRRLPVDLNDLGRCIDLDALRHALRDR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttattcaaaagcgcgcgaccttggcatcgatctggaatttgtggacgggcag
ggcctccgccatgtggtgaacggcgagcggctgcgtgccattctcgatggtttgccatcc
ccttcgcgacatccctatctgaagcaacccgttgttatcgtcgccgacggcggcgattgt
cgtgtgccggtggacgccgaagcaaacggaatcggttggcggctcgttgaacgaaacgcg
gtgcttgcgcgaggacgtgtggccggggaggcgatcgacttgccgcgttcggcggcaatc
ggcacctatcggctggagcttgtgagcgataacggggatacgatcgattcgatcccgttg
ctggtgacgccggcggccgcctatcagggctcgttcgaccgggtctgggtgctgtcggtt
caactctacggggtatcgtcgtcgggcaattggggaattggcgatttcacggacctcgcc
gcgctgatcgaattgaccgcggattggggctgcgcgggaatcggactcaatccgcttcat
gcgttgttcgatgaccggcctctcgaatgcagcccctatgcgccgaacagccggttgttc
ctcaatccgctttacatcgatcccgagcggttgccggattttccgggtgcttggctggcg
cagcatcgtgagcaacttggtcaggcccgccacggcgaactgatcgactacgcggccgtc
gcggaattgaaattcgccgcgctccggcacgcgttttcgatcttccggcgcggacgctca
cagtccgaattcgaaatcttcaggcaggagcgcggcgaactgctgcaacgctttgcctgc
ttcgaagtgctgcggcggcaattcggtccattgccgtggtggcaatggccggaggaatgg
cgtcgccccgacgacgcgcggattcaggcctttcgaaacggtttgctgcgtgccgaggtt
gaattcgtcgagttcgtgcaatggtgcgcggcggcgcagttgcagtcatgcgccgatctt
gccgctgaacgcggaatggcggtcggcctttatctcgatgttgccgtcggggttcaggcc
ggcgggttcgacgcctggaacgagcagggtgccatctcgcgcgggctttcggttggtgcg
ccgcccgatcagctcaacacgaccggacaagactggggactggcggggtttaataccgct
ggactcgaggcgagcggcttcgcaccgtttcgggagatgctgcgcgcctcgatgcgtttc
gcgggcgcgatacgactggatcacgtcctcggcctcaaccggctttatctgataccgtcc
ggtgcgtcgccgcgggatggcgtgtatgtggagatgccgttggaggcgctgctcggcgtc
atcgcgcaggagagcgtcggccagcgctgcatcacgatcggggaggatctgggaacggtg
ccggacggctttcgcgacattctcgcggcttggggcgtgtggtcctacaaggtgatgatg
ttcgagcgcggtcatgacggcgcttttatcgggccgtcgggttatgccgcgaacgccctt
gtcactttcaacacgcatgatcttgcatcgtttgcaggctggcaatcgcactccgatctc
agggtcaagcgagagcttggtctcgatcccggcgagacggacgcgatgcgggcggatgcg
ctccgtgcgttcgaatggaagctccgcgaagaccatatcgcgtcgaagaattttttcgga
gccgtcgaatttctagcgcacacgccgtcgcgcattcttgcggtcgcgctcgacgatctg
atcggattgaaggatcagccgaacattccaggaacggtgaatgagcaccccaactggcgg
cggcggcttccggttgatctgaacgatctcggccgctgcatcgatctcgacgcacttcgg
cacgcgctccgcgaccgctga

DBGET integrated database retrieval system