KEGG   Nitrobacter hamburgensis: Nham_1733Help
Entry
Nham_1733         CDS       T00348                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01130  Biosynthesis of antibiotics
nha01230  Biosynthesis of amino acids
Module
nha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nham_1733
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nham_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABE62548
JGI: Nham1733
UniProt: Q1QMJ9
Position
complement(1933357..1934202)
Genome map
AA seq 281 aa AA seqDB search
MADILTKIEAYKREEIASAKRARSLSEVLAAAEAASPPRGFVQTIRAKLASGDYALIAEV
KKASPSKGLIRADFDPPSLARAYEAGGAACLSVLTDTPSFQGHLDFMVAARTATSLPVLR
KDFMFDTYQVVEARAHGADCILIIMAALDDAAAKDIEAAALDLGMDALLEIHNRAELDRA
LKLRSPMIGVNNRNLRTFETTLETSEALAPHIPKDRVMVGESGIFAAADLARLEQVGIST
FLVGESLMRQADVTAATRALLARGGQSSPQVVPANAGTHNP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacatcctgacgaagatcgaagcctacaagcgcgaggagatcgcgagcgcaaag
cgcgcgcgctccctcagcgaggttctggccgccgccgaggctgcatctccgccgcgcggt
ttcgtccagaccatccgcgcaaaactcgccagcggtgactatgctttgatcgccgaggtc
aagaaggcctcgccctcgaagggcctgatccgcgccgacttcgatccgccttcgctggcc
cgtgcttatgaggcgggcggcgcggcctgcctctcggtcctgaccgacacgccctccttt
cagggccatctcgatttcatggtcgccgcccgcaccgccacgtcgctgccggtgctgcgc
aaggacttcatgttcgacacctatcaggtggtcgaggcccgcgcgcatggggccgactgc
atcctgatcatcatggccgcgctcgacgatgccgcggcgaaagacatcgaggcggctgcg
ctcgatctcggcatggacgcgctgctcgaaatccataaccgcgccgaactcgatcgcgcg
ctaaaacttcgctcgcctatgatcggcgtcaacaaccgcaacctccgcacctttgagacg
acgctcgaaaccagcgaagcgctggcgccgcatattccgaaggatcgcgtgatggtgggc
gaaagcggtatcttcgctgccgcagacctcgcgcggctcgaacaggttggcatctctacc
ttcctcgtcggcgaaagcctgatgcggcaggccgacgttaccgccgcaacccgcgcgctg
ctggcgcggggcggacaatcatctccacaagtcgtccctgcgaacgcagggacccataac
ccctga

DBGET integrated database retrieval system