KEGG   Nitrobacter hamburgensis: Nham_1736Help
Entry
Nham_1736         CDS       T00348                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_1736
   01230 Biosynthesis of amino acids
    Nham_1736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_1736
   00051 Fructose and mannose metabolism
    Nham_1736
   00562 Inositol phosphate metabolism
    Nham_1736
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_1736
Enzymes [BR:nha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nham_1736
Exosome [BR:nha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nham_1736
  Exosomal proteins of bladder cancer cells
   Nham_1736
  Exosomal proteins of melanoma cells
   Nham_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1937414..1938166
Genome map
AA seq 250 aa AA seqDB search
MTGLRPLIAGNWKMNGLKASASELGQMIAGAGGPAQKADLLICPPATLVLAFAGAVQGSP
LRIGAQDCHPNPSGAHTGDTSAEMLADSGATAIIVGHSERRADHGETDALVRQKAEAAWR
AALIAIVCVGETQDQRDAGQTLEVVGRQLAGSLPDGATAANLVVAYEPVWAIGTGRTPTP
KDVQDVHGFIRDQLTQRFSGEGARIRILYGGSVKPSNAAELMAVPNVNGALIGGASLKAT
DFLAIAGAVA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggctgcgaccgctgattgctggaaactggaagatgaacggcctcaaggcttcg
gccagcgaactcggccagatgatcgcaggcgcgggcggccccgcacaaaaggccgatctg
ctgatctgcccgccggcgacgctggtgcttgcctttgcgggagcggttcagggatcgccg
ctgcggatcggcgcgcaggattgccatcctaatccttccggagcccatacgggcgatacg
tccgccgagatgttggccgattcgggcgccaccgccatcatcgtcggtcactccgagcgt
cgcgccgatcacggcgagaccgacgcgcttgtgcggcaaaaggcggaagcagcgtggcgg
gcggcgttgatcgccatcgtctgcgtcggtgaaacccaggaccagcgcgatgccggtcag
acgctcgaggtggtcggacggcagcttgcgggctcgctgccggatggcgcgaccgctgca
aatctcgttgtcgcctacgagccggtctgggccattggtactggacgcacgcccacacca
aaagatgtgcaggatgtccatgggtttatcagggatcagctcacacagcgctttagcggc
gagggggccaggatccgtattctctatggcggttcggtgaagccgtcgaatgccgcggaa
ttgatggcggttccgaatgtgaacggagcgctgatcggtggcgccagcctcaaggcgaca
gatttccttgcgatcgccggggctgttgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system