KEGG   Nitrobacter hamburgensis: Nham_1751Help
Entry
Nham_1751         CDS       T00348                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_1751
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_1751
   00020 Citrate cycle (TCA cycle)
    Nham_1751
   00620 Pyruvate metabolism
    Nham_1751
Enzymes [BR:nha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nham_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1952312..1953676
Genome map
AA seq 454 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAVDEGTIAKIL
VPEGTQDVPVNDVIAVLAGDGEDVRAAASGGGASAKAEAKAEAKTESKAGAKTGSEGAIR
TPDASSSAPAPKPASSGSPTPQANGQARVFSSPLARRLAKDAGIELARIEGSGPHGRVVA
RDVEQAKSGKGLKAPAAAPAGAPSIAPAMSDKQILSLFEDGSYEVVPHDNMRRTIAQRLT
ASIQSVPHFYLTMDCDIGRLLAAREDINASAPKDKEKKPLYKLSVNDFVIKAMAIALQRV
PNANVSWTEGGMLKHRHSDIGVAVAMPGGLITPIIRKAETKSLSAISTEMKDFAGRARAR
KLKPEEYQGGTTAVSNLGMYGIKDFTAVINPPHATILAVGASEERAVVRGGKIEAAHIMS
VTLSCDHRAVDGALGAELIGAFKTLIENPVMMMV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcctgatgcccgcgctgtcgccgacgatggaaaagggcaacctcgcc
aagtggctcaagaaggagggcgacaaggtcaagtccggcgacgtcattgccgagatcgag
accgacaaggcgaccatggaagtcgaggcggtggacgagggcaccatcgcgaaaatcctg
gtgcctgagggcacgcaggatgtgccggtcaacgacgtgatcgcggtgctcgccggggac
ggcgaggatgtcagggcggcggcgagcggcggcggggcgtctgcgaaggccgaggcgaag
gccgaagcaaaaacggaatccaaggcgggagcgaaaaccggtagcgagggggcgattcga
accccggacgcatcgtccagcgcgcctgcgcccaagcctgcatcctcagggtcgccaacg
ccgcaggccaacggccaagcccgtgtgttctcctcgccgctcgctaggcggctggcgaag
gatgccgggatcgaactggcgcgcatcgagggcagcggcccgcacggccgggtcgtcgcg
cgcgacgtggagcaggcgaaatccggcaagggcctcaaggcgcccgccgctgcgcccgca
ggcgctccgtcgatcgcgccggcgatgtccgacaagcagatcctgtcgctgtttgaagac
ggctcctacgaagtcgtgccgcatgacaacatgcgccgcacgatcgcgcagcgcctgacc
gcctcgatacagagcgtgccgcatttctacctgacgatggactgcgatatcggacggctc
ttggccgcgcgcgaggacatcaacgcgtccgcaccgaaggacaaagagaagaagccgctc
tacaagctctcggtcaacgacttcgtcatcaaggcgatggcgatcgcgctgcaacgcgtt
ccgaatgccaacgtgagctggaccgagggcggcatgctcaagcacaggcattccgatatc
ggcgtcgcggttgcgatgccgggcgggctgatcacgccgatcatccgcaaggccgaaacc
aaatcgctgtcggcgatctccaccgagatgaaggatttcgccgggcgggcgcgtgcgcga
aaactcaagccagaggagtatcagggcggcaccacggcggtctctaacctcggcatgtac
ggcatcaaggatttcaccgcggtcatcaacccgccgcacgccaccatcctcgctgtcggc
gccagcgaggagcgggcggtcgtgcggggcggcaagatagaggcggcgcacatcatgagc
gtgacgctgtcctgcgatcaccgcgcggtcgacggcgcgctcggcgcggagctgatcggc
gcgttcaagacgctgatcgagaaccctgtgatgatgatggtgtga

DBGET integrated database retrieval system