KEGG   Nitrobacter hamburgensis: Nham_1760Help
Entry
Nham_1760         CDS       T00348                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nha  Nitrobacter hamburgensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nham_1760
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Nham_1760
Enzymes [BR:nha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nham_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1962896..1963921
Genome map
AA seq 341 aa AA seqDB search
MSVRAFITGASGLSLTAEEREFLRVERPWGFILFRRNVDNPLQVARLVQDFRETVGDSDA
PVLIDQEGGRVQRLGPPHWPVYPPGAMFGALYDRDRAAGLRAARLSAQLIAADLADLGIT
VDCLPLADVPASGADAVIGDRAYGADPDKVATIARAVTEGLEQGGVLPVLKHIPGHGRAT
ADTHHRLPIVNNSKADLEAVDFAAFKPLADLPMAMTAHVVFSAIDPTQPATTSATIIEQV
IRGTIGFQGLLMSDDVSMNALTGSIAERTRAIVSAGCDMVLHCNGNLDEMRQVAGETPEL
SGKALDRARRALASRKPPQPFDREAARAEFDALTGAGAAGA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtacgcgcatttatcacgggtgcgtcaggcctgagcctgacagcggaggagcgc
gagttcctccgcgtcgagcgaccatggggcttcattctgttcaggaggaatgtcgacaat
cccctgcaagtcgctcggttggttcaagactttcgagagacagtcggcgatagcgatgcc
cccgtcctgatcgatcaggaaggcggtcgcgtgcagcgactgggcccgccgcactggccg
gtctatccgccgggcgcgatgttcggcgctctctacgaccgcgaccgcgccgcggggctg
agagcggcgcggctgagcgcacaactgatcgcggccgacctcgccgatctcggcattacc
gtcgattgcctgccgctggcggacgttccggcgtccggcgccgacgccgtcatcggcgac
cgcgcctatggcgccgatccggacaaggtcgcgacaatcgcgcgcgccgtcaccgagggg
ctggagcagggcggcgttctgccggttctcaagcacattccggggcatgggcgggcgacc
gccgacacccatcatcgactgccgatcgtcaataactcgaaggccgatctggaggccgtt
gattttgctgcattcaagccgctcgccgacctgccgatggcgatgaccgcacatgttgtg
ttcagcgcgattgatcccacacaaccggccacaacttctgcgacaatcatcgaacaggtg
attcgcggcacgatcgggttccagggattgttgatgagtgatgacgtgtccatgaatgcg
ttgacgggatcgattgccgagcggaccagggcgatcgtttcggccggttgcgacatggtc
ctgcattgcaacggcaatctcgacgaaatgcgtcaggtcgccggggaaactccggagctt
tcgggaaaagcgctggatcgcgcccgacgggccttggcatcgcgcaagccgccgcagccg
ttcgaccgcgaggcggcgcgggcggaattcgatgcgttgacgggagcgggagcagcaggc
gcatga

DBGET integrated database retrieval system