KEGG   Nitrobacter hamburgensis: Nham_1794Help
Entry
Nham_1794         CDS       T00348                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nha  Nitrobacter hamburgensis
Brite
Enzymes [BR:nha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nham_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 CMAS Ubie_methyltran GCD14
Motif
Other DBs
NCBI-ProteinID: ABE62608
JGI: Nham1794
UniProt: Q1QMD9
Position
1994916..1995569
Genome map
AA seq 217 aa AA seqDB search
MSPAGPPPPEKMMFQLSLRRRGISDQRVLRAMDSVPRDVFVESDDRDDAWRDTALGIACG
QTISQPFVVAYMTERLELRDDHRVLEIGTGSGYQAAILSRLCREVVTIERFRVLADRARA
RLEQLDCDNVEVMLGDGFDIPAGAGQFDRIMVTAAMEQIPDALTARIEPDGLLIAPVGPH
NGRQTLMLLRRTNAGLVRKELIDVRFVPALPGIAREL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgccggtccgccgccgcccgagaagatgatgtttcagctcagcctgcggcga
cgcggcatcagcgatcagcgcgtcctgcgcgcgatggacagcgtcccgcgcgatgtcttc
gtggagtcggacgatcgcgacgatgcctggcgggataccgcgctcggcatcgcctgcggc
cagaccatcagccagcctttcgtcgtcgcctacatgaccgagcggctggaattgcgcgac
gaccaccgggtgttggagatcggcaccggctccggctatcaggccgcgatcctgtcgcgt
ctgtgccgcgaggtcgtgaccatcgaacggtttcgcgtgctcgccgatcgcgcccgcgcc
cggctggagcagctcgattgcgataacgtcgaggtcatgctgggcgacggattcgacatt
ccagccggggcggggcagttcgaccgcatcatggtgacggcggcgatggagcagattccg
gacgcgctgacggcccggatcgagcccgacgggcttctgatcgcgcccgtcggcccgcac
aacggacggcagacgctgatgctcctccggcggaccaacgccggacttgtccgcaaggag
ctgatcgacgtccgcttcgtgccggcgctgccgggcatcgcccgcgaactttag

DBGET integrated database retrieval system