KEGG   Nitrobacter hamburgensis: Nham_1929Help
Entry
Nham_1929         CDS       T00348                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nha  Nitrobacter hamburgensis
Brite
Enzymes [BR:nha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nham_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2145742..2147784
Genome map
AA seq 680 aa AA seqDB search
MRNPASKEVPSNEGISFSSLRRQMVENHIAARGVRDELVLDAMRRVRRELFVPERLREFA
YEDAPLPIAGEQTISQPYIVAFMVEALLLTGNERVLEIGAGSGYAAAILSEIAADVYTVE
QLGPLAEKAAGLLAELGYDNVHVLHGDGTKGWPEHAPYDAIVVAAGGPQVPEALKQQLKI
GGRLVIPVGADPRSQELVRVTRISADEYRSEDIADVRFVPLIGEGGWATARGSGRRKARG
ELHSIYSHEETLVRNLADAAESFSSIEAADLKPLMDRIGSARIVLLGEATHGTSEFYRMR
ERITRDLIIKKEFRFVAIEADWPDAARVDHYVRHFQYPPSEWTAFARFPTWMWRNTEVHD
FVSWLRKHNGTVERNERIAFHGLDLYSLYDSIRSVLNYLDEVDPDSARVARERYGCLTPW
QRDPATYGHAALTSSYPTCESHVVRALTDLLAKRQAYAEHDGERFLDAEQNARLITNAER
YYRIMYYGSRASWNLRDSHMFATLKNLLAFHGPGSKAIVWAHNSHVGNAEATEMAARGEH
NLGQLCRKAFGAQAYLVGFGTHSGTVAAASKWDGPMEIKTVRLALPKSYEQLCHATGLAR
FMLGLRGRDDLCGPAGLGKERLERAIGVIYRPETERASHYFQASLPRQFDEYIWFDNTRA
VAPLETAMIKGLPDTYPFGV
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatccggcctccaaagaagttccttccaatgaagggatttcgttttcgtctctt
cgaaggcagatggttgaaaaccatatagctgcgcgtggcgtccgcgacgagctggtgctc
gatgccatgcgtcgggtgcggcgcgaattgtttgtgccggagaggcttcgtgaattcgcc
tatgaggacgcgccgcttccgattgccggagagcaaacgatttctcaaccctacatcgtt
gccttcatggttgaagccttgttgctgacgggcaacgaaagggtactcgaaatcggcgcc
ggatccggttacgccgccgcgatattgtcggagatagcggccgacgtctacaccgtggaa
cagctcggcccgcttgccgagaaggcagcgggcttactcgctgaactcggctatgacaat
gttcacgttctgcatggcgacggcacaaaaggatggcctgagcacgcgccctatgatgcg
atcgtcgtggctgcgggcgggccgcaggttccggaagccctcaagcaacagttgaaaatt
ggcggccggctggtgattccggttggcgcagaccctcgtagtcaggaattggtacgggtc
acccggatttcggcggacgagtaccgtagtgaagacattgccgatgttcgcttcgttccg
ttgatcggagaggggggatgggcaacggccagaggaagcggccgtaggaaagcgcgcggc
gaactgcattcaatctattcgcacgaggagaccctggttcgtaatctggcggacgctgca
gaatcgttttcatcgatcgaggcagccgatctcaagccgctgatggatcggatcgggtcg
gcgcgcatcgtcctgttgggcgaagcaacccacggcacctcggaattctatcggatgcgc
gagcgcattacccgcgatcttatcatcaagaaggaatttcgctttgttgccatcgaggcc
gattggccggatgccgcgcgcgtcgatcactacgtgcggcactttcaatatccaccgtct
gaatggactgcgtttgcccggtttccgacctggatgtggcgaaataccgaggtgcacgac
ttcgtaagctggctacgcaagcataacggcacagtcgaacgcaacgagcgtatcgcgttt
catggtctcgatctctacagcctctacgattcgatccgatcggtcttgaactatctcgat
gaagttgatccggactctgcgcgggtcgctcgtgaacgctatggttgcctcacgccatgg
cagcgcgatccggcgacgtacggccatgcggcgttgaccagctcctatccgacgtgcgag
tcgcacgtagtacgtgcgcttaccgaccttcttgcgaaacgtcaggcctatgccgagcac
gacggtgaacggtttctcgacgcagaacagaacgcgcgcctcatcaccaacgcggaacgc
tactatcgcatcatgtattacggctcgcgcgcgtcctggaatttgcgcgacagccacatg
ttcgcaacactgaaaaatttgctcgcgtttcacggtccgggcagcaaggccatcgtatgg
gcgcacaactcccatgttggcaacgccgaagcgaccgaaatggccgcgcggggcgagcac
aatctgggtcaactctgccgcaaagcatttggcgcgcaggcttatctggtcggatttgga
actcatagcgggacggttgctgcggcatcgaaatgggatgggccgatggagatcaaaacc
gtgcggctggcgcttccgaagagttacgaacagttgtgtcacgcgaccgggctggcgcgt
ttcatgctgggtctgcgcggccgcgatgatctttgcgggccagccggtcttggcaaggaa
cgtctcgaacgggcgatcggcgtcatctaccggccagaaaccgaacgtgcaagccactat
tttcaagccagtctgccgcggcagttcgatgagtatatctggttcgacaacactcgcgca
gtggctccgctggagacggcgatgatcaagggccttccggatacatatccgtttggcgtg
tga

DBGET integrated database retrieval system