KEGG   Nitrobacter hamburgensis: Nham_2282Help
Entry
Nham_2282         CDS       T00348                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nha  Nitrobacter hamburgensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nha00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nha00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2535547..2536500
Genome map
AA seq 317 aa AA seqDB search
MTSSTKSSFVLGHRHLLGIEGLSVADITGLLDLSEEYVELNRQVDKKRTSLRGRTQINLF
FEASTRTQSSFEIAGKRLGADVMNMSVSSMSTRKGETLVDTAMTLNAMHPDILVMRHSAS
GAVELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRLDGLLVAICGDVLHSRVAR
SNIILLNAMGARVRVVAPSTLLPPGIERMGVEVARDMREGLDGADIVMMLRLQRERMSGS
FVPSVSEYFHYFGLDQKKLAYAKPDALVMHPGPMNRGVEIDSIVADGAQSLIREQVEMGV
AVRMAVLEALARNLPNA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtccacgaaatcgagctttgtcctcggacaccggcacctgctggggatcgag
ggcctttccgtcgccgacatcaccggcctcctcgacctttccgaagaatacgtcgaactg
aaccgccaggtggacaagaagcgcacctcgttgcgcgggcgcacgcagatcaacctgttc
ttcgaggcttcgacccgaacccagtcgtcattcgagatcgccggcaagcggctcggggcc
gacgtgatgaacatgtcggtgtcgtcgatgtcgacccgcaagggcgaaacgctggtcgat
accgcgatgacgctcaacgccatgcatccggacattcttgtgatgcgccattccgcctcc
ggcgcggtggaacttctggcgcgcaaggtcgacggctccgtcatcaatgctggcgacggc
gcgcacgaacatccgacccaggcgctgctcgacgctctgaccatccgccgcaacaaggga
cggctcgatggacttctggtcgcgatctgcggcgacgtgctgcattcgcgcgtcgcgcgc
tccaacatcatcctgctcaacgccatgggcgcgcgcgtgcgtgtcgtcgcgccttccacg
ctactgccgccgggcatcgagcgcatgggcgtcgaggtcgcccgcgacatgcgcgaggga
ctggacggcgccgatatcgtgatgatgctccggctgcaacgcgaacggatgagcggctcg
ttcgtgccgtcggtttccgagtatttccactatttcggcctcgaccagaaaaagctcgct
tatgccaaacccgacgcgctggtcatgcatccgggaccgatgaatcgcggcgtcgagatc
gactccatcgtcgcggacggcgcccagtcgctgatccgcgagcaggtggaaatgggagtg
gcggtgcggatggcggtgctggaagcgctggcaaggaatctgccgaatgcgtaa

DBGET integrated database retrieval system