KEGG   Nitrobacter hamburgensis: Nham_2322Help
Entry
Nham_2322         CDS       T00348                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
nha  Nitrobacter hamburgensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2581850..2582914
Genome map
AA seq 354 aa AA seqDB search
MVELDEHERTMAFAEVALGQIRSLRQTAIPRNYEIWYVYAAGYNCSLNRAINETLARNGK
LTESDLEQIYETYLSPIRTTDRIDKLGARVINEIDDVMTLITDLLGMTASFGDSLKGATE
NLSAADNREQVKAVVGALMTSTREMQETNKALEDRLAISKVEINNLQHSLEAIRAESMTD
PLTGLGNRKYFDRAVEDAVALAIGEGGPLSLLLFDIDHFKSFNDNYGHLTGDQVLRLVAM
SLKQTIKGQDITARYGGEEFAVVLPNTALSQALTVADHIRRAVMAKELKKKSTGEILGRV
TISVGVSLLRHGDTPDSLIERADSCLYAAKRNGRNRVICEADPECSTDFQTRVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggttgagttggacgaacatgaacgcacaatggcgttcgcggaggtggcgctcggccag
atccgatcgctgcggcagaccgcgattccgcgcaactacgagatctggtacgtctacgcc
gccggatacaactgctccctcaacagggctatcaacgagaccctggcgcgcaacggcaag
ctgaccgaatccgatctcgaacagatctacgaaacctacctctccccgatcaggaccacc
gaccgcatcgacaaactcggcgcgcgcgtcatcaacgagatcgacgacgtgatgaccctc
atcaccgatctgctcggcatgacggccagtttcggcgacagcctgaagggagcaacggag
aacctcagcgcggccgataaccgcgaacaggtcaaggcggtcgtcggggcgctgatgaca
tcgacccgcgagatgcaggagaccaacaaggcgctggaggatcggctggcgatctcgaaa
gtcgagatcaacaatctgcagcatagccttgaggcgatcagggccgagagcatgaccgat
ccgctcaccggcctcggcaatcgcaaatatttcgaccgcgccgtcgaggatgccgtggcg
ctggcgatcggcgaaggcgggccgctgtcgcttctgttgttcgacatcgaccacttcaag
tcgttcaacgacaactacggccatttgaccggcgatcaggtgctgcggctggtggcgatg
tcgctgaagcagaccatcaagggccaggacatcaccgcgcgctacggcggcgaagaattc
gcggtcgtgctgcccaataccgcgctaagccaggcgctgacggtcgccgaccacatccgc
cgcgccgtgatggccaaggaactgaagaaaaagtcgaccggtgaaatcctcggccgcgtc
accatctcggtcggcgtctcgttgcttcgccacggcgataccccggactcgctgatcgag
cgcgccgattcctgtctctatgccgccaagcgcaacggtcgcaatcgggtcatttgcgaa
gccgatccggaatgttccaccgacttccagacgcgcgtggcctga

DBGET integrated database retrieval system