KEGG   Nitrobacter hamburgensis: Nham_2346Help
Entry
Nham_2346         CDS       T00348                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Nham_2346
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_2346
  Lipid metabolism
   00071 Fatty acid degradation
    Nham_2346
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nham_2346
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nham_2346
   00626 Naphthalene degradation
    Nham_2346
Enzymes [BR:nha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nham_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2613443..2614501
Genome map
AA seq 352 aa AA seqDB search
MALMKRQSLVKFDAPLCQTVVDTPKPQGREALVRIERCGLCHSDLHIQDGYMDRGNGERL
DITRGMTLPLTLGHEIAGVVVEVGPDAPKHIVGQKKVVFPWIGCGQCRDCLAGDENFCAK
NRFLGVSVDGGFASHVLVPDTKYLLDYDPLPVNMAATLMCSGITAYGALKRLVDRPRQRN
LLLIGLGGVGMMGLAFAQAMFKQRISVADLSPAARETALRNGAAVAYDPSEGDIVKRVIK
ENDGGFNAVIDFAGNEKSMSFAVAAVARGGKIVVSGLMGGHFNLPMVQWIYKRMTIEGFM
VGTLAEAQELMALARAGKIKPTPMREEPMADAQKWMEQLRAGKVVGRVIFKN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatgaaacgccaatctctcgtcaaattcgatgcgccgctgtgtcaaaccgtt
gtcgatacgccgaagccgcagggccgcgaggcgctggtgcgcattgaacgctgcggactg
tgccattccgacctgcatatacaggacgggtatatggatcgcggcaatggcgaacggctc
gacatcacccgcggcatgacgctgccgctcacgctcggtcacgagatcgccggcgtcgtc
gtcgaggtcggcccggatgctccgaaacatatcgtcgggcagaagaaggtggtatttccc
tggatcggctgcggccaatgccgggattgcctggccggcgatgagaatttctgcgccaaa
aaccgctttctcggcgtttcggtcgacggcggattcgccagccatgtgctggtgcccgac
acaaaatacctgctcgattacgatcccctgcccgtcaacatggcggcgacgctgatgtgt
tccggcatcaccgcctatggtgcgctgaagcgcctcgtcgaccggccgcgccagcgcaac
ctgctgctgatcggcctcggcggcgtcggcatgatgggactcgcgttcgcgcaagccatg
ttcaagcagagaatctcagtcgcggacttgagccccgcggcgcgcgaaaccgcactcagg
aacggcgctgcggtggcctacgacccgtcggaaggcgatatcgtcaagcgcgtcatcaag
gagaatgacggcggcttcaacgccgtcattgatttcgccggcaacgagaagtcgatgagc
tttgcggttgcagccgttgcccgcggcggcaagatcgtggtctcgggcctgatgggcggt
catttcaacctgccgatggtgcagtggatctataagcgcatgaccattgaaggcttcatg
gtcggcacgctcgcggaggcgcaggagttgatggcactggcgcgtgccggcaagatcaag
ccgacacccatgagggaggagcccatggccgatgcccagaaatggatggagcaattgcgg
gccggcaaggtggtcggccgcgtcatcttcaagaactga

DBGET integrated database retrieval system